StarFunc result for job id Q9H9Z2

User Input

>input (209 residues)
MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTA
RAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGS
ERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQ
GPSAQGKPTYFREEEEEIHSPTLLPEAQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K3Y3	0.821	0.821	1.270E-36	209	0.967	0.967	Q8K3Y3.pdb.gz	LN28A_MOUSE Protein lin-28 homolog A OS=Mus musculus OX=10090 GN=Lin28a PE=1 SV=1
2	AFDB:Q803L0	0.460	0.475	3.631E-27	202	0.651	0.673	Q803L0.pdb.gz	LN28A_DANRE Protein lin-28 homolog A OS=Danio rerio OX=7955 GN=lin28a PE=1 SV=1
3	AFDB:A0A1B0GVD3	0.453	0.368	2.155E-26	258	0.636	0.516	A0A1B0GVD3.pdb.gz	A0A1B0GVD3_HUMAN Lin-28 homolog B OS=Homo sapiens OX=9606 GN=LIN28B PE=1 SV=1
4	AFDB:S0BDM9	0.489	0.480	6.769E-25	213	0.593	0.582	S0BDM9.pdb.gz	S0BDM9_DANRE Lin-28 homolog protein OS=Danio rerio OX=7955 GN=lin28b PE=2 SV=1
5	AFDB:Q9VRN5	0.406	0.433	2.447E-16	195	0.335	0.359	Q9VRN5.pdb.gz	LIN28_DROME Protein lin-28 homolog OS=Drosophila melanogaster OX=7227 GN=lin-28 PE=2 SV=2
6	AFDB:P92186	0.396	0.367	1.139E-12	227	0.263	0.242	P92186.pdb.gz	LIN28_CAEEL Protein lin-28 OS=Caenorhabditis elegans OX=6239 GN=lin-28 PE=1 SV=1
7	AFDB:O65639	0.337	0.241	3.771E-10	299	0.239	0.167	O65639.pdb.gz	CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1
8	AFDB:Q41188	0.348	0.358	1.771E-8	203	0.220	0.227	Q41188.pdb.gz	CSP2_ARATH Cold shock protein 2 OS=Arabidopsis thaliana OX=3702 GN=CSP2 PE=1 SV=1
9	AFDB:P45441	0.382	0.254	1.876E-8	324	0.273	0.176	P45441.pdb.gz	YBX2B_XENLA Y-box-binding protein 2-B OS=Xenopus laevis OX=8355 GN=ybx2-b PE=1 SV=2
10	AFDB:P21574	0.387	0.247	1.987E-8	336	0.287	0.179	P21574.pdb.gz	YBX2A_XENLA Y-box-binding protein 2-A OS=Xenopus laevis OX=8355 GN=ybx2-a PE=1 SV=3
11	PDB:2l15A	0.320	0.918	3.794E-6	70	0.144	0.429	2l15A.pdb.gz
12	PDB:1zeqX	0.297	0.635	2.821E-4	84	0.062	0.155	1zeqX.pdb.gz
13	PDB:3aqqA	0.274	0.547	8.900E-4	99	0.115	0.242	3aqqA.pdb.gz
14	PDB:2lxjA	0.283	0.837	1.057E-3	66	0.124	0.394	2lxjA.pdb.gz
15	PDB:1bbuA	0.263	0.125	7.041E-3	486	0.048	0.021	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
16	PDB:6d6qI	0.290	0.327	1.115E-2	183	0.043	0.049	6d6qI.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
17	PDB:1e1tA	0.258	0.123	2.353E-2	485	0.048	0.021	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
18	PDB:1u5kA	0.280	0.246	3.321E-2	242	0.043	0.037	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
19	PDB:5zg8A	0.253	0.140	3.725E-2	422	0.077	0.038	5zg8A.pdb.gz
20	PDB:7qxbP	0.208	0.185	4.965E-2	251	0.067	0.056	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9H9Z2	1.16e-155	431	209	1.000	1.000	LN28A_HUMAN Protein lin-28 homolog A OS=Homo sapiens OX=9606 GN=LIN28A PE=1 SV=1
2	Q8K3Y3	5.80e-151	419	209	0.967	0.967	LN28A_MOUSE Protein lin-28 homolog A OS=Mus musculus OX=10090 GN=Lin28a PE=1 SV=1
3	Q803L0	3.40e-93	272	202	0.656	0.678	LN28A_DANRE Protein lin-28 homolog A OS=Danio rerio OX=7955 GN=lin28a PE=1 SV=1
4	Q6ZN17	4.12e-88	261	250	0.622	0.520	LN28B_HUMAN Protein lin-28 homolog B OS=Homo sapiens OX=9606 GN=LIN28B PE=1 SV=1
5	A0A1B0GVD3	4.50e-88	261	258	0.622	0.504	A0A1B0GVD3_HUMAN Lin-28 homolog B OS=Homo sapiens OX=9606 GN=LIN28B PE=1 SV=1
6	S0BDM9	6.83e-74	224	213	0.560	0.549	S0BDM9_DANRE Lin-28 homolog protein OS=Danio rerio OX=7955 GN=lin28b PE=2 SV=1
7	Q9VRN5	6.42e-28	106	195	0.301	0.323	LIN28_DROME Protein lin-28 homolog OS=Drosophila melanogaster OX=7227 GN=lin-28 PE=2 SV=2
8	P92186	3.52e-17	79.0	227	0.254	0.233	LIN28_CAEEL Protein lin-28 OS=Caenorhabditis elegans OX=6239 GN=lin-28 PE=1 SV=1
9	D4A3P0	5.23e-14	71.6	359	0.211	0.123	D4A3P0_RAT Y box binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ybx2 PE=1 SV=1
10	P62960	5.59e-14	71.2	322	0.172	0.112	YBOX1_MOUSE Y-box-binding protein 1 OS=Mus musculus OX=10090 GN=Ybx1 PE=1 SV=3
11	P62961	5.59e-14	71.2	322	0.172	0.112	YBOX1_RAT Y-box-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ybx1 PE=2 SV=3
12	Q9Y2T7	5.83e-14	71.6	364	0.211	0.121	YBOX2_HUMAN Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN=YBX2 PE=1 SV=2
13	P67809	5.95e-14	71.2	324	0.172	0.111	YBOX1_HUMAN Y-box-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3
14	P21574	6.05e-14	71.2	336	0.172	0.107	YBX2A_XENLA Y-box-binding protein 2-A OS=Xenopus laevis OX=8355 GN=ybx2-a PE=1 SV=3
15	P45441	1.10e-13	70.5	324	0.172	0.111	YBX2B_XENLA Y-box-binding protein 2-B OS=Xenopus laevis OX=8355 GN=ybx2-b PE=1 SV=2
16	O65639	1.33e-13	70.1	299	0.230	0.161	CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1
17	B5DE31	1.39e-13	70.1	310	0.172	0.116	YBOX1_DANRE Y-box-binding protein 1 OS=Danio rerio OX=7955 GN=ybx1 PE=1 SV=1
18	A0A8I5ZJP8	2.62e-13	68.9	282	0.177	0.131	A0A8I5ZJP8_RAT Y box binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ybx2 PE=4 SV=1
19	Q9Z2C8	2.70e-13	69.7	360	0.191	0.111	YBOX2_MOUSE Y-box-binding protein 2 OS=Mus musculus OX=10090 GN=Ybx2 PE=1 SV=1
20	P16989	4.02e-12	66.2	372	0.167	0.094	YBOX3_HUMAN Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00313 CSD	3.3e-13	60.6	'Cold-shock' DNA-binding domain
2	PF00575 S1	4.6e+02	12.6	S1 RNA binding domain
3	PF00098 zf-CCHC	0.0019	29.4	Zinc knuckle
4	PF15288 zf-CCHC_6	1.2e+02	14.0	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363314

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257177	0.995	Terminal uridylyltransferase 4
2	9606.ENSP00000259915	0.994	POU domain, class 5, transcription factor 1
3	9606.ENSP00000229307	0.987	Homeobox protein NANOG
4	9606.ENSP00000308000	0.979	Speckle targeted PIP5K1A-regulated poly(A) polymerase
5	9606.ENSP00000323588	0.972	Transcription factor SOX-2
6	9606.ENSP00000356520	0.970	ATP-dependent RNA helicase A
7	9606.ENSP00000363804	0.969	Krueppel-like factor 4
8	9606.ENSP00000365130	0.963	Terminal uridylyltransferase 7
9	9606.ENSP00000373272	0.930	E3 ubiquitin-protein ligase TRIM71
10	9606.ENSP00000217086	0.927	Sal-like protein 4
11	9606.ENSP00000419901	0.897	LINE1 type transposase domain containing 1
12	9606.ENSP00000252463	0.868	Zinc finger and SCAN domain-containing protein 10
13	9606.ENSP00000479618	0.866	Myc proto-oncogene protein
14	9606.ENSP00000276594	0.858	PR domain zinc finger protein 14
15	9606.ENSP00000335306	0.825	Developmental pluripotency-associated protein 4
16	9606.ENSP00000437256	0.821	Endoribonuclease Dicer
17	9606.ENSP00000290341	0.809	Insulin-like growth factor 2 mRNA-binding protein 1
18	9606.ENSP00000264657	0.805	Signal transducer and activator of transcription 3
19	9606.ENSP00000331745	0.792	Growth/differentiation factor 3
20	9606.ENSP00000425979	0.785	Ribonuclease 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.991	mRNA binding
GO:0003677	0.823	DNA binding
GO:0061980	0.806	regulatory RNA binding
GO:0035198	0.790	miRNA binding
GO:0031369	0.786	translation initiation factor binding
GO:1990825	0.758	sequence-specific mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0070918	0.994	regulatory ncRNA processing
GO:0048522	0.988	positive regulation of cellular process
GO:0080090	0.983	regulation of primary metabolic process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0035196	0.983	miRNA processing
GO:0009893	0.978	positive regulation of metabolic process
GO:0034661	0.976	ncRNA catabolic process
GO:0010608	0.971	post-transcriptional regulation of gene expression
GO:0032501	0.961	multicellular organismal process
GO:0032502	0.944	developmental process
GO:0051171	0.942	regulation of nitrogen compound metabolic process
GO:0010604	0.939	positive regulation of macromolecule metabolic process
GO:0031123	0.939	RNA 3'-end processing
GO:0010556	0.921	regulation of macromolecule biosynthetic process
GO:0031326	0.921	regulation of cellular biosynthetic process
GO:0051173	0.917	positive regulation of nitrogen compound metabolic process
GO:0031325	0.917	positive regulation of cellular metabolic process
GO:0010557	0.882	positive regulation of macromolecule biosynthetic process
GO:0031328	0.881	positive regulation of cellular biosynthetic process
GO:0006417	0.878	regulation of translation
GO:0051247	0.834	positive regulation of protein metabolic process
GO:0010628	0.816	positive regulation of gene expression
GO:0048856	0.739	anatomical structure development
GO:0045727	0.726	positive regulation of translation
GO:0048523	0.597	negative regulation of cellular process
GO:0051252	0.535	regulation of RNA metabolic process
GO:0051172	0.451	negative regulation of nitrogen compound metabolic process
GO:0031324	0.447	negative regulation of cellular metabolic process
GO:0010558	0.386	negative regulation of macromolecule biosynthetic process
GO:0031327	0.383	negative regulation of cellular biosynthetic process
GO:0010586	0.349	miRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0031981	1.000	nuclear lumen
GO:0032991	0.992	protein-containing complex
GO:0005829	0.990	cytosol
GO:0005730	0.984	nucleolus
GO:0005654	0.962	nucleoplasm
GO:0012505	0.759	endomembrane system
GO:1990904	0.546	ribonucleoprotein complex
GO:0005783	0.340	endoplasmic reticulum
GO:0035770	0.329	ribonucleoprotein granule
GO:0036464	0.321	cytoplasmic ribonucleoprotein granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]