StarFunc result for job id Q9HA38

User Input

>input (289 residues)
MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQD
CALEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHGKKLRNYYAANSCPPPARMSNVVEPA
ATPVVPVPPQMGSFKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QSNSFSESSELGQRRARKEGNEFKMMPNRRNMYTVQNNSAGPYFNPRSRQRIPRDLAMCV
TPSGQFYCSMCNVGAGEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494C120	0.217	0.172	4.125E-42	383	0.945	0.713	A0A494C120.pdb.gz	A0A494C120_HUMAN Zinc finger matrin-type 3 OS=Homo sapiens OX=9606 GN=ZMAT3 PE=1 SV=1
2	AFDB:O54836	0.425	0.424	2.567E-40	290	0.869	0.866	O54836.pdb.gz	ZMAT3_MOUSE Zinc finger matrin-type protein 3 OS=Mus musculus OX=10090 GN=Zmat3 PE=2 SV=1
3	AFDB:F4K209	0.170	0.063	2.074E-7	995	0.201	0.058	F4K209.pdb.gz	F4K209_ARATH Endonuclease or glycosyl hydrolase with C2H2-type zinc finger domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MAF19.19 PE=1 SV=1
4	AFDB:E7FE25	0.141	0.095	5.119E-7	439	0.228	0.150	E7FE25.pdb.gz
5	AFDB:Q569K4	0.169	0.150	4.900E-6	471	0.239	0.146	Q569K4.pdb.gz	Z385B_HUMAN Zinc finger protein 385B OS=Homo sapiens OX=9606 GN=ZNF385B PE=1 SV=1
6	AFDB:Q9H6B1	0.150	0.114	8.945E-5	395	0.197	0.144	Q9H6B1.pdb.gz	Z385D_HUMAN Zinc finger protein 385D OS=Homo sapiens OX=9606 GN=ZNF385D PE=2 SV=1
7	AFDB:A0A494C0L7	0.180	0.077	2.208E-4	820	0.142	0.050	A0A494C0L7.pdb.gz	A0A494C0L7_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
8	AFDB:E9QJ33	0.131	0.086	4.491E-4	459	0.221	0.139	E9QJ33.pdb.gz	E9QJ33_DANRE Zinc finger protein 385C OS=Danio rerio OX=7955 GN=znf385c PE=4 SV=2
9	AFDB:A0A024R885	0.183	0.082	4.790E-4	898	0.135	0.043	A0A024R885.pdb.gz
10	AFDB:Q5SYW2	0.175	0.074	1.039E-3	870	0.125	0.041	Q5SYW2.pdb.gz	Q5SYW2_HUMAN CDKN1A interacting zinc finger protein 1 OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=1
11	PDB:5gm6I	0.121	0.322	3.889E-1	102	0.045	0.127	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:5z56v	0.126	0.215	4.720E-1	167	0.048	0.084	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.
13	PDB:6g90U	0.129	0.185	6.952E-1	196	0.038	0.056	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
14	PDB:5nrlU	0.127	0.182	9.600E-1	196	0.038	0.056	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
15	PDB:3ephA	0.146	0.106	1.092	402	0.045	0.032	3ephA.pdb.gz	Crystallographic snapshots of eukaryotic dimethylallyltransferase acting on tRNA: insight into tRNA recognition and reaction mechanism.
16	PDB:6n7pB	0.146	0.209	1.092	195	0.042	0.062	6n7pB.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
17	PDB:6g90T	0.111	0.070	1.165	462	0.028	0.017	6g90T.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	PDB:6qx91C	0.105	0.467	1.165	50	0.045	0.260	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:7abiF	0.110	0.181	1.165	165	0.045	0.079	7abiF.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
20	PDB:5zwmv	0.115	0.190	1.243	174	0.031	0.052	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494C120	0.0	560	383	0.945	0.713	A0A494C120_HUMAN Zinc finger matrin-type 3 OS=Homo sapiens OX=9606 GN=ZMAT3 PE=1 SV=1
2	O08781	0.0	523	289	0.879	0.879	ZMAT3_RAT Zinc finger matrin-type protein 3 OS=Rattus norvegicus OX=10116 GN=Zmat3 PE=2 SV=1
3	O54836	0.0	508	290	0.869	0.866	ZMAT3_MOUSE Zinc finger matrin-type protein 3 OS=Mus musculus OX=10090 GN=Zmat3 PE=2 SV=1
4	Q9HA38	0.0	596	289	1.000	1.000	ZMAT3_HUMAN Zinc finger matrin-type protein 3 OS=Homo sapiens OX=9606 GN=ZMAT3 PE=1 SV=1
5	C9J8H5	4.60e-105	304	148	0.512	1.000	C9J8H5_HUMAN Zinc finger matrin-type 3 (Fragment) OS=Homo sapiens OX=9606 GN=ZMAT3 PE=1 SV=1
6	Q9H898	3.98e-12	66.6	229	0.138	0.175	ZMAT4_HUMAN Zinc finger matrin-type protein 4 OS=Homo sapiens OX=9606 GN=ZMAT4 PE=1 SV=1
7	Q9R0B7	4.28e-11	64.3	294	0.197	0.194	ZN346_MOUSE Zinc finger protein 346 OS=Mus musculus OX=10090 GN=Znf346 PE=1 SV=1
8	D6RJ07	1.69e-09	60.1	310	0.125	0.116	D6RJ07_HUMAN Zinc finger protein 346 OS=Homo sapiens OX=9606 GN=ZNF346 PE=1 SV=1
9	Q8AVN9	1.88e-09	60.5	524	0.138	0.076	ZN346_XENLA Zinc finger protein 346 OS=Xenopus laevis OX=8355 GN=znf346 PE=1 SV=1
10	Q9UL40	1.99e-09	59.7	294	0.125	0.122	ZN346_HUMAN Zinc finger protein 346 OS=Homo sapiens OX=9606 GN=ZNF346 PE=1 SV=1
11	Q569K4	3.50e-07	53.5	471	0.190	0.117	Z385B_HUMAN Zinc finger protein 385B OS=Homo sapiens OX=9606 GN=ZNF385B PE=1 SV=1
12	F4K209	6.22e-06	49.7	995	0.163	0.047	F4K209_ARATH Endonuclease or glycosyl hydrolase with C2H2-type zinc finger domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MAF19.19 PE=1 SV=1
13	Q96PM9	5.75e-05	46.6	386	0.194	0.145	Z385A_HUMAN Zinc finger protein 385A OS=Homo sapiens OX=9606 GN=ZNF385A PE=1 SV=2
14	Q8VD12	1.45e-04	45.1	386	0.190	0.142	Z385A_MOUSE Zinc finger protein 385A OS=Mus musculus OX=10090 GN=Znf385a PE=1 SV=2
15	Q66K41	7.50e-04	43.1	422	0.059	0.040	Z385C_HUMAN Zinc finger protein 385C OS=Homo sapiens OX=9606 GN=ZNF385C PE=1 SV=4
16	B7Z4J8	0.012	38.5	196	0.048	0.071	B7Z4J8_HUMAN Zinc finger protein 346 OS=Homo sapiens OX=9606 GN=ZNF346 PE=1 SV=1
17	E9QJ33	0.015	38.9	459	0.048	0.031	E9QJ33_DANRE Zinc finger protein 385C OS=Danio rerio OX=7955 GN=znf385c PE=4 SV=2
18	Q9H6B1	0.021	38.5	395	0.055	0.041	Z385D_HUMAN Zinc finger protein 385D OS=Homo sapiens OX=9606 GN=ZNF385D PE=2 SV=1
19	Q99PP2	0.11	36.6	2237	0.087	0.011	ZN318_MOUSE Zinc finger protein 318 OS=Mus musculus OX=10090 GN=Znf318 PE=1 SV=3
20	Q6GQU3	0.12	36.2	547	0.048	0.026	Q6GQU3_MOUSE Ciz1 protein OS=Mus musculus OX=10090 GN=Ciz1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19088 TUTase	2.5e-06	38.5	TUTase nucleotidyltransferase domain
2	PF12756 zf-C2H2_2	4e-05	35.2	C2H2 type zinc-finger (2 copies)
3	PF13894 zf-C2H2_4	1.7	20.6	C2H2-type zinc finger
4	PF12171 zf-C2H2_jaz	7.2e-20	82.0	Zinc-finger double-stranded RNA-binding
5	PF12874 zf-met	2.2e-19	80.4	Zinc-finger of C2H2 type
6	PF06220 zf-U1	0.011	26.8	U1 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311221

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346694	0.850	Heterogeneous nuclear ribonucleoproteins A2/B1
2	9606.ENSP00000397157	0.769	P53 apoptosis effector related to PMP-22
3	9606.ENSP00000278903	0.724	Etoposide-induced protein 2.4 homolog
4	9606.ENSP00000356280	0.684	Pleckstrin homology-like domain family A member 3
5	9606.ENSP00000341874	0.682	Serine/threonine-protein kinase RIO3
6	9606.ENSP00000420037	0.672	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
7	9606.ENSP00000376390	0.667	Ras-related protein Rab-37
8	9606.ENSP00000371398	0.660	Zinc finger protein GLIS3
9	9606.ENSP00000313601	0.656	Coiled-coil and C2 domain-containing protein 1A
10	9606.ENSP00000320566	0.654	Inhibitor of growth protein 3
11	9606.ENSP00000319974	0.652	HMG box transcription factor BBX
12	9606.ENSP00000313582	0.651	Zinc finger protein 436
13	9606.ENSP00000266987	0.645	RISC-loading complex subunit TARBP2
14	9606.ENSP00000271555	0.572	Myocyte-specific enhancer factor 2D
15	9606.ENSP00000269305	0.564	Cellular tumor antigen p53
16	9606.ENSP00000482604	0.564	Hematopoietic SH2 domain-containing protein
17	9606.ENSP00000344635	0.562	Cyclin-G1
18	9606.ENSP00000470879	0.554	Transmembrane protein 59-like
19	9606.ENSP00000393762	0.550	Sestrin-1
20	9606.ENSP00000331944	0.545	Apoptosis-enhancing nuclease

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.997	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048522	0.989	positive regulation of cellular process
GO:0010941	0.937	regulation of cell death
GO:0010942	0.862	positive regulation of cell death
GO:0048519	0.830	negative regulation of biological process
GO:0048523	0.783	negative regulation of cellular process
GO:0043067	0.783	regulation of programmed cell death
GO:0043068	0.679	positive regulation of programmed cell death
GO:0042981	0.636	regulation of apoptotic process
GO:0043065	0.459	positive regulation of apoptotic process
GO:0009987	0.414	cellular process
GO:0019222	0.336	regulation of metabolic process
GO:0060255	0.327	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016020	0.995	membrane
GO:0005886	0.952	plasma membrane
GO:0043232	0.561	intracellular non-membrane-bounded organelle
GO:0005737	0.518	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]