StarFunc result for job id Q9HA47

User Input

>input (277 residues)
MASAGGEDCESPAPEADRPHQRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRQRKVV
ILSQDRFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKNIVEGKTVEVPTYDFVTH
SRLPETTVVYPADVVLFEGILVFYSQEIRDMFHLRLFVDTDSDVRLSRRVLRDVRRGRDL
EQILTQYTTFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQHIQDILNGDICKWHR
GGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P52623	0.844	0.844	3.109E-51	277	0.917	0.917	P52623.pdb.gz	UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus OX=10090 GN=Uck1 PE=1 SV=2
2	AFDB:Q99PM9	0.801	0.850	4.252E-41	261	0.671	0.713	Q99PM9.pdb.gz	UCK2_MOUSE Uridine-cytidine kinase 2 OS=Mus musculus OX=10090 GN=Uck2 PE=1 SV=1
3	PDB:6pwzB	0.734	0.940	7.085E-34	215	0.617	0.795	6pwzB.pdb.gz	Incorporation of novel azido-nucleotides into RNA
4	AFDB:A0A0S2Z5Y6	0.680	0.893	2.689E-33	210	0.755	0.995	A0A0S2Z5Y6.pdb.gz	A0A0S2Z5Y6_HUMAN uridine/cytidine kinase (Fragment) OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1
5	AFDB:Q9FKS0	0.729	0.420	1.394E-29	486	0.408	0.233	Q9FKS0.pdb.gz	UKL1_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL1 PE=1 SV=1
6	AFDB:Q8VYB2	0.731	0.438	4.452E-29	466	0.394	0.234	Q8VYB2.pdb.gz	UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=UKL3 PE=2 SV=1
7	AFDB:Q9NWZ5	0.723	0.370	1.511E-28	548	0.375	0.190	Q9NWZ5.pdb.gz	UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1 PE=1 SV=2
8	AFDB:H2L2A8	0.719	0.355	3.408E-27	569	0.422	0.206	H2L2A8.pdb.gz	H2L2A8_CAEEL Uridine kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_F19B6.1 PE=1 SV=1
9	AFDB:P67413	0.702	0.912	3.764E-25	212	0.314	0.410	P67413.pdb.gz	URK_STRPN Uridine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=udk PE=1 SV=1
10	AFDB:P27515	0.707	0.396	6.522E-25	501	0.332	0.184	P27515.pdb.gz	URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URK1 PE=1 SV=1
11	AFDB:O74427	0.726	0.447	1.843E-24	454	0.329	0.200	O74427.pdb.gz	URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urk1 PE=3 SV=1
12	PDB:2gesA	0.571	0.518	1.834E-12	308	0.170	0.153	2gesA.pdb.gz	Invariance and variability in bacterial PanK: a study based on the crystal structure of Mycobacterium tuberculosis PanK.
13	PDB:5xmbB	0.579	0.600	2.646E-12	267	0.170	0.176	5xmbB.pdb.gz
14	PDB:1esmA	0.567	0.510	4.674E-11	311	0.148	0.132	1esmA.pdb.gz	Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
15	PDB:6h7gA	0.547	0.453	6.743E-11	340	0.166	0.135	6h7gA.pdb.gz
16	PDB:1odfA	0.470	0.466	1.142E-8	280	0.184	0.182	1odfA.pdb.gz
17	PDB:2p0eA	0.477	0.665	5.261E-8	190	0.134	0.195	2p0eA.pdb.gz	Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
18	PDB:1t3hC	0.376	0.523	2.967E-6	187	0.126	0.187	1t3hC.pdb.gz
19	PDB:1qf9A	0.349	0.470	4.550E-6	194	0.144	0.206	1qf9A.pdb.gz	pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog.
20	PDB:1ukyA	0.419	0.561	5.142E-6	196	0.159	0.224	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52623	0.0	527	277	0.917	0.917	UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus OX=10090 GN=Uck1 PE=1 SV=2
2	Q9HA47	0.0	577	277	1.000	1.000	UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1
3	A0A0S2Z5Y6	6.74e-151	422	210	0.758	1.000	A0A0S2Z5Y6_HUMAN uridine/cytidine kinase (Fragment) OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1
4	Q99PM9	7.76e-131	373	261	0.661	0.701	UCK2_MOUSE Uridine-cytidine kinase 2 OS=Mus musculus OX=10090 GN=Uck2 PE=1 SV=1
5	Q9QYG8	7.76e-131	373	261	0.661	0.701	UCK2_RAT Uridine-cytidine kinase 2 OS=Rattus norvegicus OX=10116 GN=Uck2 PE=2 SV=2
6	Q9BZX2	8.85e-131	373	261	0.668	0.709	UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1
7	H2L2A8	1.92e-68	223	569	0.397	0.193	H2L2A8_CAEEL Uridine kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_F19B6.1 PE=1 SV=1
8	Q9FKS0	2.53e-67	218	486	0.430	0.245	UKL1_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL1 PE=1 SV=1
9	Q9LK34	1.12e-66	217	483	0.404	0.232	UKL2_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL2 PE=1 SV=1
10	Q9NWZ5	8.31e-65	213	548	0.372	0.188	UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1 PE=1 SV=2
11	Q8VYB2	9.26e-65	211	466	0.404	0.240	UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=UKL3 PE=2 SV=1
12	O74427	1.23e-53	182	454	0.332	0.203	URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urk1 PE=3 SV=1
13	P67413	2.39e-44	151	212	0.278	0.363	URK_STRPN Uridine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=udk PE=1 SV=1
14	P27515	2.80e-43	155	501	0.321	0.178	URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URK1 PE=1 SV=1
15	P0A8F4	5.31e-42	145	213	0.271	0.352	URK_ECOLI Uridine kinase OS=Escherichia coli (strain K12) OX=83333 GN=udk PE=3 SV=1
16	Q9C664	1.26e-19	90.5	674	0.224	0.092	TTM2_ARATH Inorganic pyrophosphatase TTM2 OS=Arabidopsis thaliana OX=3702 GN=TTM2 PE=1 SV=1
17	Q9C9B9	9.92e-17	82.0	643	0.202	0.087	TTM1_ARATH Inorganic pyrophosphatase TTM1 OS=Arabidopsis thaliana OX=3702 GN=TTM1 PE=1 SV=1
18	P25697	3.80e-15	76.6	395	0.209	0.147	KPPR_ARATH Phosphoribulokinase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g32060 PE=1 SV=1
19	P19824	1.92e-12	68.9	375	0.191	0.141	KPPR_CHLRE Phosphoribulokinase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=PRKA PE=1 SV=1
20	Q12084	1.26e-11	65.1	232	0.188	0.224	DAS2_YEAST Putative uridine kinase DAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	55	15.6	AAA domain
2	PF13238 AAA_18	0.47	22.4	AAA domain
3	PF01121 CoaE	0.053	24.7	Dephospho-CoA kinase
4	PF07813 LTXXQ	92	15.2	LTXXQ motif family protein
5	PF00485 PRK	1.1e-49	180.4	Phosphoribulokinase / Uridine kinase family
6	PF09547 SpoIVA_ATPase	4.4e+02	11.6	Stage IV sporulation protein A, ATPase domain
7	PF00437 T2SSE	3.7e+02	11.5	Type II/IV secretion system protein
8	PF06414 Zeta_toxin	4.4	18.2	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003822444.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003814450.1	0.997	This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis
2	9597.XP_003824444.1	0.990	Uracil phosphoribosyltransferase homolog
3	9597.XP_003805875.1	0.960	Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
4	9597.XP_003826835.1	0.958	RAB28, member RAS oncogene family
5	9597.XP_003832750.1	0.954	Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
6	9597.XP_003816227.1	0.950	Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and CMP as phosphate acceptors. Also displays broad nucleoside diphosphate kinase activity
7	9597.XP_008953212.1	0.950	Cytidine/uridine monophosphate kinase 1
8	9597.XP_003825265.1	0.945	Uridine monophosphate synthetase
9	9597.XP_008969780.1	0.939	Calcium activated nucleotidase 1
10	9597.XP_003817064.1	0.934	Belongs to the GDA1/CD39 NTPase family.
11	9597.XP_003826112.1	0.933	Belongs to the GDA1/CD39 NTPase family.
12	9597.XP_008960546.1	0.921	Belongs to the uridine kinase family.
13	9597.XP_003825447.1	0.913	Belongs to the GDA1/CD39 NTPase family.
14	9597.XP_008962707.1	0.913	UMP-CMP kinase 2, mitochondrial
15	9597.XP_003824199.1	0.903	Belongs to the GDA1/CD39 NTPase family.
16	9597.XP_003827708.1	0.903	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
17	9597.XP_008951258.1	0.903	Ectonucleotide pyrophosphatase/phosphodiesterase 3
18	9597.XP_008968585.1	0.903	Ectonucleoside triphosphate diphosphohydrolase 6 isoform X1
19	9597.XP_008975460.1	0.903	Ectonucleoside triphosphate diphosphohydrolase 4 isoform X1
20	9597.XP_008959138.1	0.897	5'(3')-deoxyribonucleotidase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019206	1.000	nucleoside kinase activity
GO:0016773	0.983	phosphotransferase activity, alcohol group as acceptor
GO:0004849	0.942	uridine kinase activity
GO:0042802	0.499	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009123	0.997	nucleoside monophosphate metabolic process
GO:0072528	0.996	pyrimidine-containing compound biosynthetic process
GO:0043173	0.994	nucleotide salvage
GO:0009218	0.993	pyrimidine ribonucleotide metabolic process
GO:0006221	0.993	pyrimidine nucleotide biosynthetic process
GO:0009156	0.991	ribonucleoside monophosphate biosynthetic process
GO:0009129	0.986	pyrimidine nucleoside monophosphate metabolic process
GO:0009260	0.967	ribonucleotide biosynthetic process
GO:0009199	0.702	ribonucleoside triphosphate metabolic process
GO:0009142	0.653	nucleoside triphosphate biosynthetic process
GO:0009201	0.602	ribonucleoside triphosphate biosynthetic process
GO:0009220	0.365	pyrimidine ribonucleotide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043229	0.938	intracellular organelle
GO:0043227	0.922	membrane-bounded organelle
GO:0043231	0.911	intracellular membrane-bounded organelle
GO:0012505	0.394	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	1.000	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.983	Phosphotransferases with an alcohol group as acceptor.
RHEA:16825	0.942	ATP + uridine = ADP + H(+) + UMP
EC:2.7.1.48	0.942	uridine/cytidine kinase.

[back to server]