StarFunc result for job id Q9HA77

User Input

>input (564 residues)
MLRTTRGPGLGPPLLQAALGLGRAGWHWPAGRAASGGRGRAWLQPTGRETGVQVYNSLTG
RKEPLIVAHAEAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTKVFGCSIVMVMGITD
VDDKIIKRANEMNISPASLASLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGII
ARGNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALWKAAKPQEV
FWASPWGPGRPGWHIECSAIASMVFGSQLDIHSGGIDLAFPHHENEIAQCEVFHQCEQWG
NYFLHSGHLHAKGKEEKMSKSLKNYITIKDFLKTFSPDVFRFFCLRSSYRSAIDYSDSAM
LQAQQLLLGLGSFLEDARAYMKGQLACGSVREAMLWERLSSTKRAVKAALADDFDTPRVV
DAILGLAHHGNGQLRASLKEPEGPRSPAVFGAIISYFEQFFETVGISLANQQYVSGDGSE
ATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINI
KDRSSTTSTWELLDQRTKDQKSAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FC09	0.784	0.781	2.550E-66	566	0.555	0.553	E7FC09.pdb.gz	E7FC09_DANRE cysteine--tRNA ligase OS=Danio rerio OX=7955 GN=cars2 PE=1 SV=1
2	AFDB:Q7K3P0	0.757	0.764	1.475E-50	558	0.383	0.387	Q7K3P0.pdb.gz	Q7K3P0_DROME cysteine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=CysRS-m PE=2 SV=1
3	AFDB:Q8IJP3	0.727	0.611	4.948E-46	677	0.356	0.297	Q8IJP3.pdb.gz	Q8IJP3_PLAF7 cysteine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1015200.1 PE=3 SV=2
4	AFDB:Q54KR1	0.753	0.648	8.704E-46	660	0.372	0.318	Q54KR1.pdb.gz	SYCC_DICDI Cysteine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=cysS PE=3 SV=1
5	AFDB:Q09860	0.727	0.552	5.099E-42	754	0.358	0.268	Q09860.pdb.gz	SYC_SCHPO Probable cysteine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29E6.06c PE=3 SV=1
6	AFDB:F4IPY2	0.687	0.688	2.774E-41	563	0.317	0.318	F4IPY2.pdb.gz	SYCM_ARATH Cysteine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SYCO PE=2 SV=1
7	AFDB:Q7KN90	0.688	0.531	6.308E-41	741	0.365	0.278	Q7KN90.pdb.gz	SYCC_DROME Cysteine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=CysRS PE=1 SV=1
8	AFDB:P53852	0.715	0.535	1.168E-40	767	0.367	0.270	P53852.pdb.gz	SYC_YEAST Cysteine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL247W PE=1 SV=1
9	AFDB:A0A1D6LAG9	0.685	0.685	1.951E-40	564	0.321	0.321	A0A1D6LAG9.pdb.gz	CPS1_MAIZE Cysteine--tRNA ligase CPS1, chloroplastic/mitochondrial OS=Zea mays OX=4577 GN=CPS1 PE=2 SV=1
10	AFDB:A0A024RCG3	0.678	0.518	1.062E-39	748	0.372	0.281	A0A024RCG3.pdb.gz
11	PDB:1u0bB	0.673	0.817	1.147E-35	461	0.298	0.364	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
12	PDB:1li7B	0.610	0.909	5.236E-31	375	0.252	0.379	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
13	PDB:6ax8A	0.536	0.588	7.801E-12	509	0.128	0.141	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
14	PDB:5yymA	0.476	0.464	7.146E-10	581	0.106	0.103	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
15	PDB:4ariA	0.514	0.365	7.978E-9	821	0.135	0.093	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
16	PDB:1f7uA	0.483	0.453	9.797E-9	606	0.098	0.091	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding
17	PDB:5b63C	0.466	0.474	2.345E-8	553	0.112	0.114	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
18	PDB:4r3zB	0.475	0.414	1.039E-7	659	0.115	0.099	4r3zB.pdb.gz
19	PDB:3zgzD	0.527	0.356	2.756E-7	867	0.137	0.089	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
20	PDB:4h3sA	0.328	0.318	1.169E-5	585	0.076	0.074	4h3sA.pdb.gz	The Structure of Yeast Glutaminyl-tRNA Synthetase and Modeling of Its Interaction with tRNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FC09	0.0	657	566	0.557	0.555	E7FC09_DANRE cysteine--tRNA ligase OS=Danio rerio OX=7955 GN=cars2 PE=1 SV=1
2	Q7K3P0	1.84e-123	376	558	0.376	0.380	Q7K3P0_DROME cysteine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=CysRS-m PE=2 SV=1
3	Q54KR1	5.62e-112	350	660	0.379	0.324	SYCC_DICDI Cysteine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=cysS PE=3 SV=1
4	Q8IJP3	6.49e-100	319	677	0.369	0.307	Q8IJP3_PLAF7 cysteine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1015200.1 PE=3 SV=2
5	Q09860	2.31e-82	275	754	0.289	0.216	SYC_SCHPO Probable cysteine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC29E6.06c PE=3 SV=1
6	F4IPY2	2.06e-80	265	563	0.323	0.323	SYCM_ARATH Cysteine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SYCO PE=2 SV=1
7	P21888	2.43e-79	259	461	0.271	0.332	SYC_ECOLI Cysteine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=cysS PE=1 SV=2
8	A0A1D6LAG9	6.96e-76	253	564	0.312	0.312	CPS1_MAIZE Cysteine--tRNA ligase CPS1, chloroplastic/mitochondrial OS=Zea mays OX=4577 GN=CPS1 PE=2 SV=1
9	P53852	1.79e-75	256	767	0.291	0.214	SYC_YEAST Cysteine--tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL247W PE=1 SV=1
10	B4DKY1	1.29e-72	248	739	0.293	0.223	B4DKY1_HUMAN cysteine--tRNA ligase OS=Homo sapiens OX=9606 GN=CARS1 PE=1 SV=1
11	P49589	1.90e-72	248	748	0.303	0.229	SYCC_HUMAN Cysteine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=CARS1 PE=1 SV=3
12	Q9CEJ0	2.14e-72	240	448	0.277	0.348	SYC_LACLA Cysteine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=cysS PE=3 SV=1
13	B3LFA4	1.71e-71	239	511	0.252	0.278	SYCC2_ARATH Cysteine--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At5g38830 PE=2 SV=1
14	Q585F2	4.40e-70	242	785	0.282	0.203	Q585F2_TRYB2 cysteine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.350 PE=3 SV=1
15	Q7KN90	1.10e-69	240	741	0.280	0.213	SYCC_DROME Cysteine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=CysRS PE=1 SV=1
16	P9WFW1	1.36e-67	228	469	0.309	0.371	SYC_MYCTU Cysteine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cysS PE=1 SV=1
17	C8V9N8	1.19e-58	211	833	0.254	0.172	C8V9N8_EMENI cysteine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08800 PE=3 SV=1
18	P9WJM9	3.15e-55	194	414	0.239	0.326	MSHC_MYCTU L-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mshC PE=1 SV=1
19	Q499X9	0.13	37.7	586	0.044	0.043	SYMM_MOUSE Methionine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Mars2 PE=1 SV=2
20	Q15031	0.62	35.4	903	0.067	0.042	SYLM_HUMAN Leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00133 tRNA-synt_1	0.3	21.0	tRNA synthetases class I (I, L, M and V)
2	PF01406 tRNA-synt_1e	2.1e-107	370.5	tRNA synthetases class I (C) catalytic domain
3	PF01921 tRNA-synt_1f	0.39	21.2	tRNA synthetases class I (K)
4	PF09334 tRNA-synt_1g	1e-09	49.3	tRNA synthetases class I (M)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257347

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362576	0.972	Tyrosine--tRNA ligase, cytoplasmic
2	9606.ENSP00000355890	0.949	Bifunctional glutamate/proline--tRNA ligase
3	9606.ENSP00000377954	0.930	Leucine--tRNA ligase, cytoplasmic
4	9606.ENSP00000364794	0.928	Isoleucine--tRNA ligase, cytoplasmic
5	9606.ENSP00000355889	0.925	Isoleucine--tRNA ligase, mitochondrial
6	9606.ENSP00000472847	0.917	Serine--tRNA ligase, mitochondrial
7	9606.ENSP00000261772	0.908	Alanine--tRNA ligase, cytoplasmic
8	9606.ENSP00000358549	0.892	Probable arginine--tRNA ligase, mitochondrial
9	9606.ENSP00000408576	0.888	Probable leucine--tRNA ligase, mitochondrial
10	9606.ENSP00000441000	0.879	Valine--tRNA ligase, mitochondrial
11	9606.ENSP00000307567	0.878	Glutamine--tRNA ligase
12	9606.ENSP00000234677	0.867	Serine--tRNA ligase, cytoplasmic
13	9606.ENSP00000360327	0.867	Probable proline--tRNA ligase, mitochondrial
14	9606.ENSP00000320658	0.866	Tyrosine--tRNA ligase, mitochondrial
15	9606.ENSP00000262027	0.851	Methionine--tRNA ligase, cytoplasmic
16	9606.ENSP00000358060	0.835	Threonine--tRNA ligase, mitochondrial
17	9606.ENSP00000369897	0.820	Cysteine--tRNA ligase, cytoplasmic
18	9606.ENSP00000282276	0.815	Methionine--tRNA ligase, mitochondrial
19	9606.ENSP00000281038	0.813	Probable asparagine--tRNA ligase, mitochondrial
20	9606.ENSP00000235521	0.812	Tryptophan--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004817	0.997	cysteine-tRNA ligase activity
GO:0005488	0.995	binding
GO:1901363	0.940	heterocyclic compound binding
GO:0097159	0.940	organic cyclic compound binding
GO:0005515	0.866	protein binding
GO:0043167	0.834	ion binding
GO:0003676	0.336	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0044249	0.991	cellular biosynthetic process
GO:0006139	0.987	nucleobase-containing compound metabolic process
GO:0010467	0.986	gene expression
GO:0044260	0.986	cellular macromolecule metabolic process
GO:1901566	0.985	organonitrogen compound biosynthetic process
GO:0019538	0.984	protein metabolic process
GO:0034645	0.981	cellular macromolecule biosynthetic process
GO:0043043	0.981	peptide biosynthetic process
GO:0006399	0.976	tRNA metabolic process
GO:0006520	0.975	amino acid metabolic process
GO:0043039	0.972	tRNA aminoacylation
GO:0006412	0.970	translation
GO:0006418	0.964	tRNA aminoacylation for protein translation
GO:0065007	0.322	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005739	0.994	mitochondrion
GO:0070013	0.927	intracellular organelle lumen
GO:0005829	0.919	cytosol
GO:0031981	0.313	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:17773	0.997	ATP + L-cysteine + tRNA(Cys) = AMP + diphosphate + L-cysteinyl-tRNA(Cys)
EC:6.1.1.16	0.997	cysteine--tRNA ligase.

[back to server]