StarFunc result for job id Q9HA92

User Input

>input (442 residues)
MALPGARARGWAAAARAAQRRRRVENAGGSPSPEPAGRRAALYVHWPYCEKRCSYCNFNK
YIPRRLEEAAMQKCLVTEAQTLLRLSGVQRVESVFFGGGTPSLASPHTVAAVLEAVAQAA
HLPADLEVTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSLDDTELRLLGRTHSACDALRT
LAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHCDDHLSLYQLSLERGTALFAQV
QRGALPAPDPELAAEMYQRGRAVLREAGFHQYEVSNFARNGALSTHNWTYWQCGQYLGVG
PGAHGRFMPQGAGGHTREARIQTLEPDNWMKEVMLFGHGTRKRVPLGRLELLEEVLALGL
RTDVGITHQHWQQFEPQLTLWDVFGANKEVQELLERGLLQLDHRGLRCSWEGLAVLDSLL
LTLLPQLQEAWQQRTPSPVPGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HA92	1.000	1.000	2.041E-92	442	1.000	1.000	Q9HA92.pdb.gz	RSAD1_HUMAN Radical S-adenosyl methionine domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=RSAD1 PE=1 SV=2
2	AFDB:Q5SUV1	0.929	0.929	3.063E-77	442	0.842	0.842	Q5SUV1.pdb.gz	RSAD1_MOUSE Radical S-adenosyl methionine domain-containing protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Rsad1 PE=2 SV=1
3	AFDB:P54304	0.804	0.932	6.811E-35	379	0.260	0.303	P54304.pdb.gz	HEMW_BACSU Heme chaperone HemW OS=Bacillus subtilis (strain 168) OX=224308 GN=hemW PE=2 SV=3
4	AFDB:Q9CGF7	0.782	0.907	2.973E-33	379	0.233	0.272	Q9CGF7.pdb.gz	HEMW_LACLA Heme chaperone HemW OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=hemW PE=1 SV=1
5	AFDB:P52062	0.772	0.897	4.448E-32	378	0.258	0.302	P52062.pdb.gz	HEMW_ECOLI Heme chaperone HemW OS=Escherichia coli (strain K12) OX=83333 GN=hemW PE=1 SV=1
6	AFDB:P73245	0.765	0.818	1.835E-30	412	0.265	0.284	P73245.pdb.gz	HEMW_SYNY3 Heme chaperone HemW OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=hemW PE=1 SV=1
7	AFDB:P0A1E1	0.742	0.720	7.700E-27	457	0.199	0.193	P0A1E1.pdb.gz	HEMN_SALTY Oxygen-independent coproporphyrinogen III oxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=hemN PE=3 SV=1
8	PDB:1oltA	0.726	0.739	5.591E-26	434	0.197	0.200	1oltA.pdb.gz	Crystal Structure of Coproporphyrinogen III Oxidase Reveals Cofactor Geometry of Radical Sam Enzymes
9	AFDB:P51008	0.704	0.693	5.277E-25	450	0.204	0.200	P51008.pdb.gz	HEMN_CERS4 Oxygen-independent coproporphyrinogen III oxidase OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=hemZ PE=3 SV=1
10	AFDB:P77915	0.718	0.692	2.159E-24	460	0.199	0.191	P77915.pdb.gz	HEMN_PSEAE Oxygen-independent coproporphyrinogen III oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=hemN PE=2 SV=2
11	AFDB:P74132	0.727	0.692	1.107E-23	466	0.186	0.176	P74132.pdb.gz	HEMN_SYNY3 Oxygen-independent coproporphyrinogen III oxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=hemN PE=1 SV=1
12	PDB:6qk7C	0.386	0.384	1.790E-7	444	0.115	0.115	6qk7C.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
13	PDB:3t7vA	0.317	0.404	5.224E-7	337	0.088	0.116	3t7vA.pdb.gz	Crystal structure of methylornithine synthase (PylB): insights into the pyrrolysine biosynthesis.
14	PDB:6iadA	0.387	0.397	2.393E-6	428	0.122	0.126	6iadA.pdb.gz
15	PDB:1r30B	0.308	0.408	2.155E-5	313	0.086	0.121	1r30B.pdb.gz	Crystal structure of biotin synthase, an S-adenosylmethionine-dependent radical enzyme.
16	PDB:1nvmA	0.239	0.297	1.237E-4	340	0.057	0.074	1nvmA.pdb.gz	Crystal structure of a bifunctional aldolase-dehydrogenase: Sequestering a reactive and volatile intermediate
17	PDB:3c8fA	0.340	0.557	2.054E-4	245	0.086	0.155	3c8fA.pdb.gz	Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
18	PDB:4hnvB	0.238	0.117	1.053E-3	1033	0.054	0.023	4hnvB.pdb.gz	Characterizing the Importance of the Biotin Carboxylase Domain Dimer for Staphylococcus aureus Pyruvate Carboxylase Catalysis.
19	PDB:2j5tH	0.115	0.138	1.563E-3	337	0.111	0.145	2j5tH.pdb.gz	A Novel Two-Domain Architecture within the Amino Acid Kinase Enzyme Family Revealed by the Crystal Structure of Escherichia Coli Glutamate 5-Kinase.
20	PDB:4jn6C	0.232	0.291	1.653E-3	339	0.043	0.056	4jn6C.pdb.gz	Characterization of an Aldolase-Dehydrogenase Complex from the Cholesterol Degradation Pathway of Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SUV1	0.0	696	442	0.814	0.814	RSAD1_MOUSE Radical S-adenosyl methionine domain-containing protein 1, mitochondrial OS=Mus musculus OX=10090 GN=Rsad1 PE=2 SV=1
2	Q9HA92	0.0	892	442	1.000	1.000	RSAD1_HUMAN Radical S-adenosyl methionine domain-containing protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=RSAD1 PE=1 SV=2
3	P54304	1.31e-55	191	379	0.244	0.285	HEMW_BACSU Heme chaperone HemW OS=Bacillus subtilis (strain 168) OX=224308 GN=hemW PE=2 SV=3
4	P52062	1.74e-49	174	378	0.226	0.265	HEMW_ECOLI Heme chaperone HemW OS=Escherichia coli (strain K12) OX=83333 GN=hemW PE=1 SV=1
5	Q9CGF7	1.72e-46	166	379	0.242	0.282	HEMW_LACLA Heme chaperone HemW OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=hemW PE=1 SV=1
6	P73245	2.03e-45	164	412	0.258	0.277	HEMW_SYNY3 Heme chaperone HemW OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=hemW PE=1 SV=1
7	P32131	1.97e-21	98.6	457	0.215	0.208	HEMN_ECOLI Oxygen-independent coproporphyrinogen III oxidase OS=Escherichia coli (strain K12) OX=83333 GN=hemN PE=1 SV=4
8	P77915	1.34e-19	93.2	460	0.176	0.170	HEMN_PSEAE Oxygen-independent coproporphyrinogen III oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=hemN PE=2 SV=2
9	P0A1E1	1.58e-19	92.8	457	0.149	0.144	HEMN_SALTY Oxygen-independent coproporphyrinogen III oxidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=hemN PE=3 SV=1
10	P51008	7.16e-18	87.8	450	0.186	0.182	HEMN_CERS4 Oxygen-independent coproporphyrinogen III oxidase OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=hemZ PE=3 SV=1
11	O34162	5.28e-16	82.4	494	0.127	0.113	HEMN_CUPNH Oxygen-independent coproporphyrinogen III oxidase OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=hemN PE=2 SV=2
12	P74132	1.65e-12	71.2	466	0.138	0.131	HEMN_SYNY3 Oxygen-independent coproporphyrinogen III oxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=hemN PE=1 SV=1
13	D5VRB9	2.18e-04	45.8	534	0.075	0.062	ELP3_METIM tRNA uridine(34) acetyltransferase OS=Methanocaldococcus infernus (strain DSM 11812 / JCM 15783 / ME) OX=573063 GN=Metin_0452 PE=1 SV=1
14	Q93ZR1	0.002	42.7	565	0.113	0.088	ELP3_ARATH Elongator complex protein 3 OS=Arabidopsis thaliana OX=3702 GN=HAG3 PE=1 SV=1
15	Q57YY2	0.003	42.4	666	0.052	0.035	Q57YY2_TRYB2 Elongator complex protein 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.330 PE=3 SV=1
16	B4DKA4	0.008	40.8	475	0.106	0.099	B4DKA4_HUMAN Elongator complex protein 3 OS=Homo sapiens OX=9606 GN=ELP3 PE=1 SV=1
17	Q02908	0.011	40.4	557	0.095	0.075	ELP3_YEAST Elongator complex protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ELP3 PE=1 SV=1
18	O14023	0.013	40.4	544	0.113	0.092	ELP3_SCHPO Elongator complex protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=elp3 PE=3 SV=1
19	Q9H9T3	0.013	40.4	547	0.106	0.086	ELP3_HUMAN Elongator complex protein 3 OS=Homo sapiens OX=9606 GN=ELP3 PE=1 SV=2
20	Q23651	0.016	40.0	547	0.111	0.090	ELP3_CAEEL Elongator complex protein 3 OS=Caenorhabditis elegans OX=6239 GN=elpc-3 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06969 HemN_C	1.3e-07	42.9	HemN C-terminal domain
2	PF04055 Radical_SAM	5.1e-12	58.0	Radical SAM superfamily
3	PF18052 Rx_N	6.4e+02	12.0	Rx N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258955

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264193	0.777	Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial
2	9606.ENSP00000386284	0.739	Delta-aminolevulinic acid dehydratase
3	9606.ENSP00000357787	0.735	Uroporphyrinogen-III synthase
4	9606.ENSP00000372326	0.730	Ferrochelatase, mitochondrial
5	9606.ENSP00000419475	0.728	COMM domain-containing protein 2
6	9606.ENSP00000246337	0.695	Uroporphyrinogen decarboxylase
7	9606.ENSP00000356202	0.692	Peptide chain release factor 1-like, mitochondrial
8	9606.ENSP00000370718	0.683	N-acetylserotonin O-methyltransferase-like protein
9	9606.ENSP00000367346	0.672	Arginine-hydroxylase NDUFAF5, mitochondrial
10	9606.ENSP00000002125	0.630	Protein arginine methyltransferase NDUFAF7, mitochondrial
11	9606.ENSP00000357199	0.627	Protein RRNAD1
12	9606.ENSP00000288828	0.617	WD repeat domain phosphoinositide-interacting protein 2
13	9606.ENSP00000278715	0.601	Porphobilinogen deaminase
14	9606.ENSP00000381036	0.601	Androglobin
15	9606.ENSP00000382163	0.599	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
16	9606.ENSP00000350874	0.572	Methyltransferase-like protein 9
17	9606.ENSP00000434887	0.572	Threonine synthase like 1
18	9606.ENSP00000401706	0.564	Olfactory receptor 5H14
19	9606.ENSP00000362282	0.558	Molybdenum cofactor biosynthesis protein 1
20	9606.ENSP00000357829	0.555	EEF1A lysine methyltransferase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0020037	1.000	heme binding
GO:0005515	0.878	protein binding
GO:0003824	0.870	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006807	0.998	nitrogen compound metabolic process
GO:0046483	0.998	heterocycle metabolic process
GO:1901360	0.997	organic cyclic compound metabolic process
GO:0034641	0.993	cellular nitrogen compound metabolic process
GO:0006725	0.990	cellular aromatic compound metabolic process
GO:1901564	0.970	organonitrogen compound metabolic process
GO:0033013	0.896	tetrapyrrole metabolic process
GO:0006778	0.892	porphyrin-containing compound metabolic process
GO:0044238	0.889	primary metabolic process
GO:0044271	0.867	cellular nitrogen compound biosynthetic process
GO:1901566	0.852	organonitrogen compound biosynthetic process
GO:0018130	0.843	heterocycle biosynthetic process
GO:1901362	0.833	organic cyclic compound biosynthetic process
GO:0019438	0.828	aromatic compound biosynthetic process
GO:0043170	0.694	macromolecule metabolic process
GO:0006779	0.560	porphyrin-containing compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.978	intracellular organelle lumen
GO:0031981	0.344	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]