StarFunc result for job id Q9HAB3

User Input

>input (445 residues)
MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNL
GLLVVTLWRRLAPGKDEQVPIRVVQVLGMVGTALLASLWHHVAPVAGQLHSVAFLALAFV
LALACCASNVTFLPFLSHLPPRFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPINGT
PGPPLDFLERFPASTFFWALTALLVASAAAFQGLLLLLPPPPSVPTGELGSGLQVGAPGA
EEEVEESSPLQEPPSQAAGTTPGPDPKAYQLLSARSACLLGLLAATNALTNGVLPAVQSF
SCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLGGLSLLGVFCGGYLMALAVLS
PCPPLVGTSAGVVLVVLSWVLCLGVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGA
VAMFPPTSIYHVFHSRKDCADPCDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAB3	1.000	1.000	6.938E-61	445	1.000	1.000	Q9HAB3.pdb.gz	S52A2_HUMAN Solute carrier family 52, riboflavin transporter, member 2 OS=Homo sapiens OX=9606 GN=SLC52A2 PE=1 SV=1
2	AFDB:Q9NWF4	0.791	0.786	2.844E-47	448	0.867	0.862	Q9NWF4.pdb.gz	S52A1_HUMAN Solute carrier family 52, riboflavin transporter, member 1 OS=Homo sapiens OX=9606 GN=SLC52A1 PE=1 SV=2
3	AFDB:B5MEV3	0.776	0.769	3.449E-43	450	0.804	0.796	B5MEV3.pdb.gz	S52A2_RAT Solute carrier family 52, riboflavin transporter, member 2 OS=Rattus norvegicus OX=10116 GN=Slc52a2 PE=2 SV=2
4	AFDB:Q4FZU9	0.719	0.693	1.734E-27	463	0.438	0.421	Q4FZU9.pdb.gz	S52A3_RAT Solute carrier family 52, riboflavin transporter, member 3 OS=Rattus norvegicus OX=10116 GN=Slc52a3 PE=1 SV=1
5	AFDB:Q9NQ40	0.748	0.712	7.464E-27	469	0.427	0.405	Q9NQ40.pdb.gz	S52A3_HUMAN Solute carrier family 52, riboflavin transporter, member 3 OS=Homo sapiens OX=9606 GN=SLC52A3 PE=1 SV=4
6	AFDB:G4SDH4	0.807	0.756	2.871E-25	476	0.299	0.279	G4SDH4.pdb.gz	S52AB_CAEEL Riboflavin transporter rft-2 OS=Caenorhabditis elegans OX=6239 GN=rft-2 PE=1 SV=2
7	AFDB:Q3LFN0	0.714	0.741	6.885E-24	427	0.328	0.342	Q3LFN0.pdb.gz	S52AA_CAEEL Riboflavin transporter rft-1 OS=Caenorhabditis elegans OX=6239 GN=rft-1 PE=1 SV=2
8	AFDB:Q9V9S9	0.731	0.673	1.311E-23	487	0.330	0.302	Q9V9S9.pdb.gz	Q9V9S9_DROME Riboflavin transporter OS=Drosophila melanogaster OX=7227 GN=Rift PE=3 SV=3
9	AFDB:Q8R139	0.674	0.578	1.097E-10	528	0.164	0.138	Q8R139.pdb.gz	S29A4_MOUSE Equilibrative nucleoside transporter 4 OS=Mus musculus OX=10090 GN=Slc29a4 PE=1 SV=1
10	AFDB:Q7RTT9	0.692	0.592	1.547E-10	530	0.169	0.142	Q7RTT9.pdb.gz	S29A4_HUMAN Equilibrative nucleoside transporter 4 OS=Homo sapiens OX=9606 GN=SLC29A4 PE=1 SV=1
11	PDB:6ob6B	0.587	0.719	5.834E-8	357	0.115	0.143	6ob6B.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
12	PDB:6ob7A	0.626	0.721	1.707E-7	381	0.128	0.150	6ob7A.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
13	PDB:7aaqA	0.556	0.516	1.920E-5	487	0.119	0.109	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
14	PDB:7sptA	0.565	0.538	2.093E-5	470	0.135	0.128	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
15	PDB:7n98A	0.509	0.486	3.503E-5	473	0.160	0.150	7n98A.pdb.gz
16	PDB:7c76B	0.512	0.478	3.817E-5	483	0.139	0.128	7c76B.pdb.gz
17	PDB:3o7qA	0.509	0.541	1.070E-4	414	0.128	0.138	3o7qA.pdb.gz
18	PDB:6s4mA	0.528	0.548	1.166E-4	426	0.139	0.146	6s4mA.pdb.gz
19	PDB:7wsmA	0.521	0.504	1.869E-4	464	0.162	0.155	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
20	PDB:6thaA	0.504	0.501	2.636E-4	448	0.137	0.136	6thaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5MEV3	0.0	615	450	0.807	0.798	S52A2_RAT Solute carrier family 52, riboflavin transporter, member 2 OS=Rattus norvegicus OX=10116 GN=Slc52a2 PE=2 SV=2
2	Q9HAB3	0.0	855	445	1.000	1.000	S52A2_HUMAN Solute carrier family 52, riboflavin transporter, member 2 OS=Homo sapiens OX=9606 GN=SLC52A2 PE=1 SV=1
3	Q9NWF4	0.0	670	448	0.865	0.859	S52A1_HUMAN Solute carrier family 52, riboflavin transporter, member 1 OS=Homo sapiens OX=9606 GN=SLC52A1 PE=1 SV=2
4	Q4FZU9	3.39e-97	301	463	0.440	0.423	S52A3_RAT Solute carrier family 52, riboflavin transporter, member 3 OS=Rattus norvegicus OX=10116 GN=Slc52a3 PE=1 SV=1
5	Q9D6X5	2.07e-96	299	460	0.445	0.430	S52A3_MOUSE Solute carrier family 52, riboflavin transporter, member 3 OS=Mus musculus OX=10090 GN=Slc52a3 PE=1 SV=3
6	Q9NQ40	5.59e-93	290	469	0.438	0.416	S52A3_HUMAN Solute carrier family 52, riboflavin transporter, member 3 OS=Homo sapiens OX=9606 GN=SLC52A3 PE=1 SV=4
7	Q9V9S9	8.80e-72	236	487	0.344	0.314	Q9V9S9_DROME Riboflavin transporter OS=Drosophila melanogaster OX=7227 GN=Rift PE=3 SV=3
8	Q3LFN0	2.58e-57	196	427	0.330	0.344	S52AA_CAEEL Riboflavin transporter rft-1 OS=Caenorhabditis elegans OX=6239 GN=rft-1 PE=1 SV=2
9	Q8SYL6	6.48e-50	176	395	0.256	0.289	Q8SYL6_DROME Riboflavin transporter OS=Drosophila melanogaster OX=7227 GN=Rift PE=2 SV=1
10	G4SDH4	4.66e-40	151	476	0.297	0.277	S52AB_CAEEL Riboflavin transporter rft-2 OS=Caenorhabditis elegans OX=6239 GN=rft-2 PE=1 SV=2
11	Q6DIC0	0.16	37.0	1577	0.049	0.014	SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1
12	Q6EDY6	1.2	34.3	1374	0.047	0.015	CARL1_MOUSE F-actin-uncapping protein LRRC16A OS=Mus musculus OX=10090 GN=Carmil1 PE=1 SV=2
13	Q9NK54	1.2	34.3	1711	0.027	0.007	CHIF_DROME Protein chiffon OS=Drosophila melanogaster OX=7227 GN=chif PE=1 SV=2
14	A0A0B4K7J2	3.6	32.7	2718	0.074	0.012	RBP2_DROME E3 SUMO-protein ligase RanBP2 OS=Drosophila melanogaster OX=7227 GN=Nup358 PE=1 SV=1
15	F1QUT1	3.9	32.7	1399	0.036	0.011	F1QUT1_DANRE Period circadian clock 2 OS=Danio rerio OX=7955 GN=fj43b09 PE=4 SV=3
16	X2J9P4	4.4	32.3	940	0.063	0.030	X2J9P4_DROME Dipeptidyl peptidase 10, isoform B OS=Drosophila melanogaster OX=7227 GN=Dpp10 PE=4 SV=1
17	Q9VMB4	4.6	32.3	935	0.063	0.030	Q9VMB4_DROME Dipeptidyl peptidase 10, isoform A OS=Drosophila melanogaster OX=7227 GN=Dpp10 PE=2 SV=3
18	O54728	5.1	32.3	1450	0.034	0.010	PLB1_RAT Phospholipase B1, membrane-associated OS=Rattus norvegicus OX=10116 GN=Plb1 PE=1 SV=1
19	Q7TPB0	8.4	31.2	716	0.056	0.035	PLPR3_MOUSE Phospholipid phosphatase-related protein type 3 OS=Mus musculus OX=10090 GN=Plppr3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06237 DUF1011	2.4e-33	125.7	Protein of unknown function (DUF1011)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436768

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000426638	0.741	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
2	9606.ENSP00000330098	0.619	F-box/LRR-repeat protein 6
3	9606.ENSP00000473159	0.587	Free fatty acid receptor 2
4	9606.ENSP00000454468	0.579	Transmembrane protein 249
5	9606.ENSP00000292180	0.561	FAD synthase
6	9606.ENSP00000310547	0.557	Uncharacterized aarF domain-containing protein kinase 5
7	9606.ENSP00000297524	0.523	Solute carrier family 7 member 13
8	9606.ENSP00000320648	0.514	WD repeat-containing protein 97
9	9606.ENSP00000436785	0.508	Solute carrier family 35 member F2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032217	1.000	riboflavin transmembrane transporter activity
GO:0038023	0.490	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071702	0.997	organic substance transport
GO:0008152	0.988	metabolic process
GO:0071705	0.985	nitrogen compound transport
GO:0009987	0.984	cellular process
GO:0051180	0.982	vitamin transport
GO:0015711	0.973	organic anion transport
GO:0071704	0.928	organic substance metabolic process
GO:0044281	0.906	small molecule metabolic process
GO:0006766	0.885	vitamin metabolic process
GO:0044237	0.739	cellular metabolic process
GO:0006807	0.712	nitrogen compound metabolic process
GO:0006767	0.708	water-soluble vitamin metabolic process
GO:1901564	0.656	organonitrogen compound metabolic process
GO:1901360	0.517	organic cyclic compound metabolic process
GO:0046483	0.469	heterocycle metabolic process
GO:0032218	0.343	riboflavin transport
GO:0034641	0.319	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:35015	1.000	riboflavin(in) = riboflavin(out)

[back to server]