StarFunc result for job id Q9HAB8

User Input

>input (311 residues)
MAEMDPVAEFPQPPGAARWAEVMARFAARLGAQGRRVVLVTSGGTKVPLEARPVRFLDNF
SSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLSALRPSGPALSGLLSLEA
EENALPGFAEALRSYQEAAAAGTFLAVEFTTLADYLHLLQAAAQALNPLGPSAMFYLAAA
VSDFYVPVSEMPEHKIQSSGGPLQITMKMVPKLLSPLVKDWAPKAFIISFKLETDPAIVI
NRARKALEIYQHQVVVANILESRQSFVFIVTKDSETKLLLSEEEIEKGVEIEEKIVDNLQ
SRHTAFIGDRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAB8	1.000	1.000	3.444E-66	311	1.000	1.000	Q9HAB8.pdb.gz	PPCS_HUMAN Phosphopantothenate--cysteine ligase OS=Homo sapiens OX=9606 GN=PPCS PE=1 SV=2
2	PDB:7edzB	0.962	0.978	2.694E-58	306	0.974	0.990	7edzB.pdb.gz	The Coenzyme A Level Modulator Hopantenate (HoPan) Inhibits Phosphopantotenoylcysteine Synthetase Activity.
3	PDB:1p9oB	0.865	0.959	1.097E-48	280	0.887	0.986	1p9oB.pdb.gz
4	AFDB:Q7KN99	0.935	0.929	1.943E-39	313	0.389	0.387	Q7KN99.pdb.gz	Q7KN99_DROME Phosphopantothenoylcysteine synthetase, isoform A OS=Drosophila melanogaster OX=7227 GN=Ppcs PE=1 SV=1
5	AFDB:Q9USK7	0.902	0.889	1.830E-37	316	0.405	0.399	Q9USK7.pdb.gz	YJ2I_SCHPO Uncharacterized protein C4B3.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4B3.18 PE=3 SV=1
6	AFDB:Q8GXR5	0.890	0.874	2.188E-35	317	0.399	0.391	Q8GXR5.pdb.gz	PPCS1_ARATH Phosphopantothenate--cysteine ligase 1 OS=Arabidopsis thaliana OX=3702 GN=PPCS1 PE=1 SV=1
7	AFDB:P40506	0.828	0.710	2.539E-30	365	0.383	0.326	P40506.pdb.gz	PPCS_YEAST Phosphopantothenate--cysteine ligase CAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB2 PE=1 SV=2
8	PDB:6ai9B	0.870	0.870	2.682E-30	311	0.363	0.363	6ai9B.pdb.gz	Crystallographic Analysis of the Catalytic Mechanism of Phosphopantothenoylcysteine Synthetase from Saccharomyces cerevisiae.
9	AFDB:Q57ZB4	0.824	0.796	7.671E-25	322	0.280	0.270	Q57ZB4.pdb.gz	Q57ZB4_TRYB2 DNA/pantothenate metabolism flavoprotein C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.880 PE=3 SV=1
10	AFDB:P0ABQ0	0.594	0.462	2.688E-12	406	0.170	0.131	P0ABQ0.pdb.gz	COABC_ECOLI Coenzyme A biosynthesis bifunctional protein CoaBC OS=Escherichia coli (strain K12) OX=83333 GN=coaBC PE=1 SV=2
11	AFDB:P9WNZ1	0.546	0.417	1.064E-11	418	0.190	0.141	P9WNZ1.pdb.gz	COABC_MYCTU Coenzyme A biosynthesis bifunctional protein CoaBC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=coaBC PE=1 SV=1
12	PDB:3n1cA	0.211	0.212	5.473E-4	309	0.109	0.110	3n1cA.pdb.gz	The Crystal Complex of Phosphofructokinase-2 of Escherichia coli with Fructose-6-phosphate: KINETIC AND STRUCTURAL ANALYSIS OF THE ALLOSTERIC ATP INHIBITION.
13	PDB:1gqtB	0.264	0.266	9.953E-4	307	0.125	0.127	1gqtB.pdb.gz	Activation of Ribokinase by Monovalent Cations.
14	PDB:7vtdA	0.268	0.270	9.098E-3	307	0.093	0.094	7vtdA.pdb.gz
15	AFDB:P76658	0.274	0.192	9.146E-3	477	0.087	0.057	P76658.pdb.gz	HLDE_ECOLI Bifunctional protein HldE OS=Escherichia coli (strain K12) OX=83333 GN=hldE PE=1 SV=1
16	PDB:2ddmB	0.284	0.316	9.658E-3	271	0.116	0.133	2ddmB.pdb.gz
17	PDB:1kflA	0.171	0.160	1.383E-2	350	0.109	0.097	1kflA.pdb.gz	Allosteric inhibition of 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase alters the coordination of both substrates.
18	AFDB:Q53W83	0.298	0.300	1.874E-2	309	0.093	0.094	Q53W83.pdb.gz	KDGK_THET8 2-dehydro-3-deoxygluconokinase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=kdgK PE=1 SV=1
19	PDB:3zmrA	0.179	0.139	2.102E-2	469	0.084	0.055	3zmrA.pdb.gz	A Discrete Genetic Locus Confers Xyloglucan Metabolism in Select Human Gut Bacteroidetes
20	PDB:7c1yA	0.240	0.218	4.573E-2	356	0.100	0.087	7c1yA.pdb.gz	Structural basis for the substrate specificity and catalytic features of pseudouridine kinase from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HAB8	0.0	627	311	1.000	1.000	PPCS_HUMAN Phosphopantothenate--cysteine ligase OS=Homo sapiens OX=9606 GN=PPCS PE=1 SV=2
2	Q7KN99	2.24e-76	238	313	0.386	0.383	Q7KN99_DROME Phosphopantothenoylcysteine synthetase, isoform A OS=Drosophila melanogaster OX=7227 GN=Ppcs PE=1 SV=1
3	E2QD26	1.96e-75	237	373	0.386	0.322	E2QD26_DROME Phosphopantothenoylcysteine synthetase, isoform C OS=Drosophila melanogaster OX=7227 GN=Ppcs PE=1 SV=1
4	Q9USK7	6.25e-70	221	316	0.424	0.418	YJ2I_SCHPO Uncharacterized protein C4B3.18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4B3.18 PE=3 SV=1
5	Q8GXR5	3.82e-67	214	317	0.367	0.360	PPCS1_ARATH Phosphopantothenate--cysteine ligase 1 OS=Arabidopsis thaliana OX=3702 GN=PPCS1 PE=1 SV=1
6	P40506	8.61e-56	186	365	0.367	0.312	PPCS_YEAST Phosphopantothenate--cysteine ligase CAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAB2 PE=1 SV=2
7	Q57ZB4	1.23e-28	114	322	0.270	0.261	Q57ZB4_TRYB2 DNA/pantothenate metabolism flavoprotein C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.880 PE=3 SV=1
8	P9WNZ1	0.054	37.4	418	0.055	0.041	COABC_MYCTU Coenzyme A biosynthesis bifunctional protein CoaBC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=coaBC PE=1 SV=1
9	P0ABQ0	2.3	32.3	406	0.042	0.032	COABC_ECOLI Coenzyme A biosynthesis bifunctional protein CoaBC OS=Escherichia coli (strain K12) OX=83333 GN=coaBC PE=1 SV=2
10	B5X131	4.5	30.8	220	0.055	0.077	B5X131_SALSA Collectrin OS=Salmo salar OX=8030 GN=TMM27 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16959 Collectrin	1e+02	14.1	Renal amino acid transporter
2	PF04127 DFP	2.9e-17	74.6	DNA / pantothenate metabolism flavoprotein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361642

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343190	0.994	Phosphopantothenoylcysteine decarboxylase
2	9606.ENSP00000302108	0.981	Pantothenate kinase 1
3	9606.ENSP00000313377	0.968	Pantothenate kinase 2, mitochondrial
4	9606.ENSP00000239231	0.965	Pantothenate kinase 3
5	9606.ENSP00000464814	0.926	Bifunctional coenzyme A synthase
6	9606.ENSP00000367727	0.833	Pantothenate kinase 4
7	9606.ENSP00000260508	0.824	Kynurenine--oxoglutarate transaminase 3
8	9606.ENSP00000359976	0.824	Cystathionine gamma-lyase
9	9606.ENSP00000399415	0.816	Kynurenine--oxoglutarate transaminase 1
10	9606.ENSP00000250535	0.804	Cysteine dioxygenase type 1
11	9606.ENSP00000245206	0.801	Aspartate aminotransferase, mitochondrial
12	9606.ENSP00000303077	0.801	Putative aspartate aminotransferase, cytoplasmic 2
13	9606.ENSP00000359539	0.801	Aspartate aminotransferase, cytoplasmic
14	9606.ENSP00000352904	0.718	Cytosolic 5'-nucleotidase 1B
15	9606.ENSP00000308515	0.706	dephospho-CoA kinase domain containing
16	9606.ENSP00000452398	0.694	Double homeobox protein A
17	9606.ENSP00000352401	0.683	Ribulose-phosphate 3-epimerase
18	9606.ENSP00000265986	0.679	Insulin-degrading enzyme
19	9606.ENSP00000314348	0.641	Probable ATP-dependent RNA helicase DDX10
20	9606.ENSP00000371230	0.633	GTP:AMP phosphotransferase AK3, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0004632	1.000	phosphopantothenate--cysteine ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:1901564	0.993	organonitrogen compound metabolic process
GO:0044281	0.990	small molecule metabolic process
GO:0034030	0.983	ribonucleoside bisphosphate biosynthetic process
GO:0034033	0.974	purine nucleoside bisphosphate biosynthetic process
GO:1901137	0.972	carbohydrate derivative biosynthetic process
GO:0015936	0.968	coenzyme A metabolic process
GO:0009152	0.960	purine ribonucleotide biosynthetic process
GO:0043603	0.952	amide metabolic process
GO:0044272	0.942	sulfur compound biosynthetic process
GO:0032501	0.935	multicellular organismal process
GO:0006637	0.907	acyl-CoA metabolic process
GO:0043604	0.891	amide biosynthetic process
GO:0006085	0.875	acetyl-CoA biosynthetic process
GO:0003008	0.600	system process
GO:0003015	0.583	heart process
GO:0015937	0.344	coenzyme A biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.917	intracellular membrane-bounded organelle
GO:0031974	0.760	membrane-enclosed lumen
GO:0070013	0.747	intracellular organelle lumen
GO:0005634	0.434	nucleus
GO:0005576	0.405	extracellular region
GO:0031982	0.384	vesicle
GO:0031981	0.376	nuclear lumen
GO:0070062	0.360	extracellular exosome
GO:0005654	0.354	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19397	1.000	(R)-4'-phosphopantothenate + CTP + L-cysteine = CMP + diphosphate + H(+) + N-[(R)-4-phosphopantothenoyl]-L-cysteine
EC:6.3.2.5	1.000	phosphopantothenate--cysteine ligase (CTP).

[back to server]