StarFunc result for job id Q9HAC8

User Input

>input (227 residues)
MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPA
FEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCL
SPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHA
QEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAC8	1.000	1.000	6.192E-46	227	1.000	1.000	Q9HAC8.pdb.gz	UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBTD1 PE=1 SV=1
2	AFDB:Q8WUN7	0.505	0.491	8.424E-33	234	0.652	0.632	Q8WUN7.pdb.gz	UBTD2_HUMAN Ubiquitin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBTD2 PE=1 SV=2
3	AFDB:Q5A109	0.332	0.390	3.558E-8	193	0.115	0.135	Q5A109.pdb.gz	RS31_CANAL Ubiquitin-ribosomal protein eS31 fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBI3 PE=1 SV=2
4	AFDB:Q9SU29	0.325	0.088	2.661E-7	873	0.176	0.046	Q9SU29.pdb.gz	UPL5_ARATH E3 ubiquitin-protein ligase UPL5 OS=Arabidopsis thaliana OX=3702 GN=UPL5 PE=1 SV=1
5	AFDB:Q9VJ33	0.317	0.833	3.396E-7	84	0.097	0.262	Q9VJ33.pdb.gz	NEDD8_DROME NEDD8 OS=Drosophila melanogaster OX=7227 GN=Nedd8 PE=1 SV=1
6	AFDB:P49632	0.323	0.561	3.836E-7	128	0.101	0.180	P49632.pdb.gz	RL40_CAEEL Ubiquitin-ribosomal protein eL40 fusion protein OS=Caenorhabditis elegans OX=6239 GN=ubq-2 PE=3 SV=2
7	AFDB:Q93725	0.317	0.901	3.836E-7	77	0.093	0.273	Q93725.pdb.gz	NEDD8_CAEEL NEDD8 OS=Caenorhabditis elegans OX=6239 GN=ned-8 PE=1 SV=1
8	AFDB:R9PY16	0.322	0.244	4.334E-7	301	0.101	0.076	R9PY16.pdb.gz	R9PY16_DROME Ubiquitin-like domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Ubi-p5E5 PE=4 SV=1
9	PDB:3dbhI	0.320	0.819	4.939E-7	86	0.093	0.244	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
10	AFDB:F4I9X6	0.318	0.227	5.204E-7	319	0.101	0.072	F4I9X6.pdb.gz	F4I9X6_ARATH Ubiquitin 13 OS=Arabidopsis thaliana OX=3702 GN=UBQ13 PE=1 SV=1
11	AFDB:Q9SHE7	0.323	0.464	5.204E-7	156	0.093	0.135	Q9SHE7.pdb.gz	RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana OX=3702 GN=RUB1 PE=1 SV=3
12	PDB:3ai5A	0.310	0.237	7.568E-7	299	0.101	0.077	3ai5A.pdb.gz
13	PDB:7rbsB	0.316	0.452	2.723E-6	157	0.079	0.115	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
14	PDB:6mdhA	0.319	0.479	4.172E-6	149	0.079	0.121	6mdhA.pdb.gz
15	PDB:6ef3u	0.302	0.860	5.659E-6	75	0.101	0.307	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
16	PDB:6yvaC	0.317	0.460	7.223E-6	155	0.062	0.090	6yvaC.pdb.gz
17	PDB:3plvA	0.300	0.819	1.596E-5	80	0.075	0.212	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
18	PDB:4pyuA	0.314	0.890	1.596E-5	76	0.066	0.197	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
19	PDB:5xqmA	0.304	0.716	1.696E-5	90	0.066	0.167	5xqmA.pdb.gz
20	PDB:1qzeA	0.295	0.312	1.619E-4	214	0.053	0.056	1qzeA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HAC8	1.14e-169	468	227	1.000	1.000	UBTD1_HUMAN Ubiquitin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBTD1 PE=1 SV=1
2	Q8WUN7	1.33e-106	308	234	0.643	0.624	UBTD2_HUMAN Ubiquitin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBTD2 PE=1 SV=2
3	B2R886	1.05e-92	271	190	0.551	0.658	B2R886_HUMAN Dendritic cell-derived ubiquitin-like protein, isoform CRA_a OS=Homo sapiens OX=9606 GN=DC-UbP PE=1 SV=1
4	Q6FTH4	1.55e-06	48.1	128	0.101	0.180	Q6FTH4_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G02475g PE=3 SV=2
5	P0CH08	1.58e-06	48.1	128	0.101	0.180	RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40A PE=1 SV=1
6	P0CH09	1.58e-06	48.1	128	0.101	0.180	RL40B_YEAST Ubiquitin-ribosomal protein eL40B fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPL40B PE=1 SV=1
7	A2Q831	1.67e-06	48.1	128	0.101	0.180	A2Q831_ASPNC Contig An01c0080, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g02880 PE=3 SV=1
8	P0CH07	1.74e-06	48.1	128	0.101	0.180	RL402_SCHPO Ubiquitin-ribosomal protein eL40B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uep1 PE=1 SV=1
9	P49632	3.01e-06	47.4	128	0.101	0.180	RL40_CAEEL Ubiquitin-ribosomal protein eL40 fusion protein OS=Caenorhabditis elegans OX=6239 GN=ubq-2 PE=3 SV=2
10	Q5A109	3.32e-06	48.1	193	0.106	0.124	RS31_CANAL Ubiquitin-ribosomal protein eS31 fusion protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBI3 PE=1 SV=2
11	P0C016	3.45e-06	47.8	150	0.101	0.153	RS27A_SCHPO Ubiquitin-ribosomal protein eS31A fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi3 PE=1 SV=2
12	P0C8R3	3.66e-06	47.4	150	0.101	0.153	RS27B_SCHPO Ubiquitin-ribosomal protein eS31B fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi5 PE=1 SV=2
13	B9DHA6	4.05e-06	47.0	128	0.101	0.180	RL40A_ARATH Ubiquitin-ribosomal protein eL40z fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPL40A PE=2 SV=1
14	Q42202	4.05e-06	47.0	128	0.101	0.180	RL40B_ARATH Ubiquitin-ribosomal protein eL40y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPL40B PE=2 SV=2
15	P05759	5.70e-06	47.0	152	0.101	0.151	RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPS31 PE=1 SV=3
16	Q8ID50	6.45e-06	46.2	128	0.101	0.180	Q8ID50_PLAF7 Ubiquitin-60S ribosomal protein L40 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1365900 PE=1 SV=1
17	P15357	6.79e-06	47.0	156	0.101	0.147	RS27A_DROME Ubiquitin-ribosomal protein eS31 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpS27A PE=1 SV=2
18	P62980	6.86e-06	47.0	156	0.101	0.147	RS27A_SOLLC Ubiquitin-ribosomal protein eS31 fusion protein OS=Solanum lycopersicum OX=4081 GN=UBI3 PE=1 SV=2
19	Q9VJ33	7.18e-06	45.1	84	0.097	0.262	NEDD8_DROME NEDD8 OS=Drosophila melanogaster OX=7227 GN=Nedd8 PE=1 SV=1
20	P18101	7.26e-06	46.2	128	0.101	0.180	RL40_DROME Ubiquitin-ribosomal protein eL40 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpL40 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11976 Rad60-SLD	0.013	26.7	Ubiquitin-2 like Rad60 SUMO-like
2	PF16455 UBD	3.7e-33	125.1	Ubiquitin-binding domain
3	PF00240 ubiquitin	1.1e-11	55.7	Ubiquitin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017248

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011090	0.697	KIAA2026
2	61853.ENSNLEP00000011572	0.630	Transmembrane protein 222
3	61853.ENSNLEP00000016979	0.565	Palmitoyltransferase
4	61853.ENSNLEP00000012213	0.559	Chromosome 1 open reading frame 52
5	61853.ENSNLEP00000020102	0.557	THUMP domain containing 2
6	61853.ENSNLEP00000016861	0.543	Exosome component 1
7	61853.ENSNLEP00000018883	0.529	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.985	organic substance metabolic process
GO:0009987	0.984	cellular process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0044238	0.977	primary metabolic process
GO:0043170	0.960	macromolecule metabolic process
GO:1901564	0.911	organonitrogen compound metabolic process
GO:0019538	0.847	protein metabolic process
GO:0065007	0.845	biological regulation
GO:0050789	0.836	regulation of biological process
GO:0050794	0.832	regulation of cellular process
GO:0019222	0.808	regulation of metabolic process
GO:0048518	0.715	positive regulation of biological process
GO:0048522	0.671	positive regulation of cellular process
GO:0044237	0.571	cellular metabolic process
GO:0036211	0.396	protein modification process
GO:0071840	0.370	cellular component organization or biogenesis
GO:0006508	0.364	proteolysis
GO:0070647	0.357	protein modification by small protein conjugation or removal
GO:0016043	0.330	cellular component organization
GO:0060255	0.328	regulation of macromolecule metabolic process
GO:0050896	0.307	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0043229	0.999	intracellular organelle
GO:0005829	0.997	cytosol
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0016020	0.917	membrane
GO:0005634	0.831	nucleus
GO:0070013	0.757	intracellular organelle lumen
GO:0031981	0.644	nuclear lumen
GO:0005654	0.336	nucleoplasm
GO:0012505	0.321	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]