StarFunc result for job id Q9HAF1

User Input

>input (191 residues)
MAMHNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRG
WDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAVSALAGVQDQLIEKREPGSGT
ESDTSPDFHNQENEPSQEDPEDLDGSVQGVKPQKAASSTSSGSHHSSHKKRKNKNRHRID
LKLNKKPRADY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAF1	1.000	1.000	1.033E-27	191	1.000	1.000	Q9HAF1.pdb.gz	EAF6_HUMAN Chromatin modification-related protein MEAF6 OS=Homo sapiens OX=9606 GN=MEAF6 PE=1 SV=1
2	AFDB:Q9VRN3	0.478	0.411	5.124E-12	225	0.424	0.360	Q9VRN3.pdb.gz	EAF6_DROME Chromatin modification-related protein MEAF6 OS=Drosophila melanogaster OX=7227 GN=Eaf6 PE=1 SV=1
3	AFDB:Q93VF4	0.410	0.475	7.237E-6	163	0.215	0.252	Q93VF4.pdb.gz	Q93VF4_ARATH Histone acetyltransferase subunit NuA4-domain protein OS=Arabidopsis thaliana OX=3702 GN=At4g14385 PE=1 SV=1
4	AFDB:Q08A72	0.159	0.090	8.392E-2	429	0.168	0.075	Q08A72.pdb.gz	EML4_ARATH Protein EMSY-LIKE 4 OS=Arabidopsis thaliana OX=3702 GN=EML4 PE=2 SV=1
5	PDB:5j9qB	0.324	0.742	1.785E-1	79	0.120	0.291	5j9qB.pdb.gz	The NuA4 Core Complex Acetylates Nucleosomal Histone H4 through a Double Recognition Mechanism
6	AFDB:Q3KPK4	0.213	0.152	4.160E-1	280	0.120	0.082	Q3KPK4.pdb.gz	BORE1_XENLA Borealin OS=Xenopus laevis OX=8355 GN=cdca8 PE=1 SV=1
7	AFDB:Q90738	0.218	0.081	6.807E-1	729	0.209	0.055	Q90738.pdb.gz	AFAP1_CHICK Actin filament-associated protein 1 OS=Gallus gallus OX=9031 GN=AFAP1 PE=1 SV=2
8	AFDB:Q6NYU3	0.222	0.149	1.047	327	0.168	0.098	Q6NYU3.pdb.gz	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
9	PDB:7suk5	0.149	0.106	1.132	296	0.063	0.041	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
10	AFDB:Q9LV52	0.240	0.145	1.340	330	0.162	0.094	Q9LV52.pdb.gz	HSFC1_ARATH Heat stress transcription factor C-1 OS=Arabidopsis thaliana OX=3702 GN=HSFC1 PE=1 SV=1
11	AFDB:Q0D311	0.164	0.090	1.425	403	0.131	0.062	Q0D311.pdb.gz	Q0D311_DANRE Basic-helix-loop-helix protein OS=Danio rerio OX=7955 GN=dec1 PE=2 SV=1
12	AFDB:Q9NPE2	0.117	0.091	1.823	291	0.183	0.120	Q9NPE2.pdb.gz	NGRN_HUMAN Neugrin OS=Homo sapiens OX=9606 GN=NGRN PE=1 SV=2
13	PDB:6qw65B	0.115	0.026	2.228	2001	0.120	0.011	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	PDB:7pqcA	0.113	0.060	4.664	445	0.047	0.020	7pqcA.pdb.gz	A Structural Ensemble of a Tau-Microtubule Complex Reveals Regulatory Tau Phosphorylation and Acetylation Mechanisms.
15	PDB:5vkqA	0.190	0.034	9.764	1499	0.089	0.011	5vkqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HAF1	2.13e-142	395	191	1.000	1.000	EAF6_HUMAN Chromatin modification-related protein MEAF6 OS=Homo sapiens OX=9606 GN=MEAF6 PE=1 SV=1
2	Q9VRN3	7.57e-43	144	225	0.346	0.293	EAF6_DROME Chromatin modification-related protein MEAF6 OS=Drosophila melanogaster OX=7227 GN=Eaf6 PE=1 SV=1
3	O14240	3.18e-12	63.2	138	0.173	0.239	EAF6_SCHPO Chromatin modification-related protein eaf6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eaf6 PE=1 SV=1
4	Q93VF4	1.36e-10	59.3	163	0.173	0.202	Q93VF4_ARATH Histone acetyltransferase subunit NuA4-domain protein OS=Arabidopsis thaliana OX=3702 GN=At4g14385 PE=1 SV=1
5	Q59QC2	1.87e-04	42.7	211	0.126	0.114	EAF6_CANAL Chromatin modification-related protein EAF6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF6 PE=3 SV=1
6	P47128	0.087	33.9	113	0.131	0.221	EAF6_YEAST Chromatin modification-related protein EAF6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EAF6 PE=1 SV=1
7	Q13183	2.6	31.2	592	0.120	0.039	S13A2_HUMAN Solute carrier family 13 member 2 OS=Homo sapiens OX=9606 GN=SLC13A2 PE=1 SV=1
8	P9WMP9	3.2	30.8	700	0.094	0.026	UVRD2_MYCTU ATP-dependent DNA helicase UvrD2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=uvrD2 PE=1 SV=1
9	Q08237	5.1	30.0	289	0.141	0.093	REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REX4 PE=1 SV=1
10	O00463	5.6	30.0	557	0.089	0.031	TRAF5_HUMAN TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2
11	Q5B836	7.5	29.6	392	0.099	0.048	Q5B836_EMENI SGNH hydrolase-type esterase domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN3294.2 PE=4 SV=1
12	P38689	7.6	29.6	320	0.173	0.103	KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS3 PE=1 SV=1
13	Q1HFU0	7.6	29.6	402	0.068	0.032	Q1HFU0_EMEND Acetylxylan esterase OS=Emericella nidulans OX=162425 GN=AN3294-2 PE=2 SV=1
14	P11717	9.5	29.6	2491	0.126	0.010	MPRI_HUMAN Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14782 BBS2_C	3.2e+02	11.4	Ciliary BBSome complex subunit 2, C-terminal
2	PF09340 NuA4	5.4e-24	95.2	Histone acetyltransferase subunit NuA4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 30611.ENSOGAP00000006060

Rank	PPI partner	STRING score	Description
1	30611.ENSOGAP00000015514	0.986	Inhibitor of growth family, member 5
2	30611.ENSOGAP00000008974	0.975	Inhibitor of growth family, member 4
3	30611.ENSOGAP00000020519	0.974	MRG/MORF4L binding protein
4	30611.ENSOGAP00000016716	0.969	Enhancer of polycomb homolog 1 (Drosophila)
5	30611.ENSOGAP00000007362	0.967	YEATS domain containing 4
6	30611.ENSOGAP00000009683	0.966	DNA methyltransferase 1 associated protein 1
7	30611.ENSOGAP00000000581	0.963	Transformation/transcription domain-associated protein
8	30611.ENSOGAP00000000937	0.962	K(lysine) acetyltransferase 7
9	30611.ENSOGAP00000008086	0.957	Enhancer of polycomb homolog 2 (Drosophila)
10	30611.ENSOGAP00000001038	0.955	K(lysine) acetyltransferase 6A
11	30611.ENSOGAP00000003761	0.955	Inhibitor of growth family, member 3
12	30611.ENSOGAP00000002289	0.953	Bromodomain and PHD finger containing, 3
13	30611.ENSOGAP00000004615	0.950	Jade family PHD finger 1
14	30611.ENSOGAP00000005406	0.950	Mortality factor 4 like 1
15	30611.ENSOGAP00000004617	0.946	Bromodomain and PHD finger containing, 1
16	30611.ENSOGAP00000012652	0.946	K(lysine) acetyltransferase 5
17	30611.ENSOGAP00000011869	0.941	Bromodomain containing 1
18	30611.ENSOGAP00000000702	0.931	Jade family PHD finger 3
19	30611.ENSOGAP00000018379	0.931	Uncharacterized protein
20	30611.ENSOGAP00000018835	0.931	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0010485	1.000	histone H4 acetyltransferase activity
GO:0010484	1.000	histone H3 acetyltransferase activity
GO:0043996	0.947	histone H4K8 acetyltransferase activity
GO:0043995	0.947	histone H4K5 acetyltransferase activity
GO:0043997	0.945	histone H4K12 acetyltransferase activity
GO:0036408	0.945	histone H3K14 acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0051173	0.983	positive regulation of nitrogen compound metabolic process
GO:0048522	0.982	positive regulation of cellular process
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0016573	0.978	histone acetylation
GO:0010556	0.975	regulation of macromolecule biosynthetic process
GO:1903506	0.969	regulation of nucleic acid-templated transcription
GO:0031325	0.958	positive regulation of cellular metabolic process
GO:0045935	0.954	positive regulation of nucleobase-containing compound metabolic process
GO:0051052	0.947	regulation of DNA metabolic process
GO:0006355	0.947	regulation of DNA-templated transcription
GO:0080135	0.909	regulation of cellular response to stress
GO:0051128	0.904	regulation of cellular component organization
GO:2001020	0.901	regulation of response to DNA damage stimulus
GO:0048584	0.899	positive regulation of response to stimulus
GO:0051054	0.897	positive regulation of DNA metabolic process
GO:0051726	0.878	regulation of cell cycle
GO:0000018	0.876	regulation of DNA recombination
GO:2000779	0.875	regulation of double-strand break repair
GO:0045739	0.875	positive regulation of DNA repair
GO:0040008	0.856	regulation of growth
GO:0043967	0.829	histone H4 acetylation
GO:0045911	0.746	positive regulation of DNA recombination
GO:2000781	0.746	positive regulation of double-strand break repair
GO:0010569	0.744	regulation of double-strand break repair via homologous recombination
GO:2000278	0.743	regulation of DNA biosynthetic process
GO:0006275	0.548	regulation of DNA replication
GO:0009987	0.394	cellular process
GO:0001558	0.346	regulation of cell growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070775	1.000	H3 histone acetyltransferase complex
GO:0005654	0.996	nucleoplasm
GO:0035267	0.996	NuA4 histone acetyltransferase complex
GO:0000786	0.927	nucleosome
GO:0099080	0.924	supramolecular complex
GO:0000779	0.918	condensed chromosome, centromeric region
GO:0000776	0.913	kinetochore
GO:0005730	0.879	nucleolus
GO:0070776	0.719	MOZ/MORF histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]