StarFunc result for job id Q9HAI6

User Input

>input (301 residues)
MLSEGYLSGLEYWNDIHWSCASYNEQVAGEKEEETNSVATLSYSSVDETQVRSLYVSCKS
SGKFISSVHSRESQHSRSQRVTVLQTNPNPVFESPNLAAVEICRDASRETYLVPSSCKSI
CKNYNDLQIAGGQVMAINSVTTDFPSESSFEYGPLLKSSEIPLPMEDSISTQPSDFPQKP
IQRYSSYWRITSIKEKSSLQMQNPISNAVLNEYLEQKVVELYKQYIMDTVFHDSSPTQIL
ASELIMTSVDQISLQVSREKNLETSKARDIVFSRLLQLMSTEITEISTPSLHISQYSNVN
P

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAI6	1.000	1.000	1.837E-43	301	1.000	1.000	Q9HAI6.pdb.gz	TASL_HUMAN TLR adapter interacting with SLC15A4 on the lysosome OS=Homo sapiens OX=9606 GN=TASL PE=1 SV=1
2	AFDB:Q5T5X7	0.128	0.055	1.935E-2	828	0.156	0.057	Q5T5X7.pdb.gz	BEND3_HUMAN BEN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=BEND3 PE=1 SV=1
3	AFDB:A3KMR8	0.135	0.131	4.454E-2	315	0.156	0.149	A3KMR8.pdb.gz	MAFA_DANRE Transcription factor MafAa OS=Danio rerio OX=7955 GN=mafaa PE=2 SV=1
4	AFDB:P46665	0.112	0.103	5.017E-2	336	0.153	0.137	P46665.pdb.gz	HAT14_ARATH Homeobox-leucine zipper protein HAT14 OS=Arabidopsis thaliana OX=3702 GN=HAT14 PE=2 SV=3
5	AFDB:P38280	0.110	0.073	1.088E-1	609	0.143	0.071	P38280.pdb.gz	YSW1_YEAST Spore-specific protein YSW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YSW1 PE=1 SV=1
6	AFDB:Q7XII4	0.091	0.088	1.226E-1	316	0.140	0.133	Q7XII4.pdb.gz	REM41_ORYSJ Remorin 4.1 OS=Oryza sativa subsp. japonica OX=39947 GN=REM4.1 PE=1 SV=1
7	AFDB:Q7L4I2	0.104	0.077	1.556E-1	434	0.159	0.111	Q7L4I2.pdb.gz	RSRC2_HUMAN Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 PE=1 SV=1
8	AFDB:Q382V3	0.101	0.060	2.224E-1	536	0.126	0.071	Q382V3.pdb.gz	Q382V3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4100 PE=4 SV=1
9	AFDB:Q95R29	0.097	0.108	2.505E-1	264	0.120	0.136	Q95R29.pdb.gz	Q95R29_DROME HL03650p OS=Drosophila melanogaster OX=7227 GN=Cipc PE=2 SV=1
10	AFDB:P17544	0.106	0.079	2.659E-1	483	0.213	0.133	P17544.pdb.gz	ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=3
11	PDB:7o4i1	0.118	0.075	2.971E-1	522	0.083	0.048	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
12	PDB:6o6pA	0.140	0.206	1.882	188	0.040	0.064	6o6pA.pdb.gz	Mycobacterium tuberculosis FasR senses long fatty acyl-CoA through a tunnel and a hydrophobic transmission spine.
13	PDB:2rvqD	0.101	0.180	2.251	129	0.070	0.163	2rvqD.pdb.gz
14	PDB:5y26B	0.107	0.271	2.389	92	0.050	0.163	5y26B.pdb.gz
15	PDB:7ksrC	0.084	0.068	2.389	397	0.063	0.048	7ksrC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
16	PDB:6ylgb	0.104	0.063	2.691	613	0.043	0.021	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
17	PDB:1yhdA	0.118	0.322	3.031	92	0.033	0.109	1yhdA.pdb.gz
18	PDB:7ksoC	0.098	0.076	3.031	420	0.050	0.036	7ksoC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
19	PDB:7rroi	0.080	0.098	3.031	235	0.093	0.119	7rroi.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:7ungi	0.075	0.088	3.031	250	0.113	0.136	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HAI6	0.0	614	301	1.000	1.000	TASL_HUMAN TLR adapter interacting with SLC15A4 on the lysosome OS=Homo sapiens OX=9606 GN=TASL PE=1 SV=1
2	Q9FV49	0.63	33.9	441	0.056	0.039	MAP21_ARATH Methionine aminopeptidase 2A OS=Arabidopsis thaliana OX=3702 GN=MAP2A PE=2 SV=2
3	P40065	4.1	31.2	302	0.113	0.113	MAM1_YEAST Monopolin complex subunit MAM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAM1 PE=1 SV=1
4	P20929	4.4	31.6	6669	0.083	0.004	NEBU_HUMAN Nebulin OS=Homo sapiens OX=9606 GN=NEB PE=1 SV=5
5	G1TDU6	6.5	31.2	6666	0.076	0.003	G1TDU6_RABIT Nebulin OS=Oryctolagus cuniculus OX=9986 GN=NEB PE=4 SV=2
6	Q9WTN3	6.5	31.2	1134	0.053	0.014	SRBP1_MOUSE Sterol regulatory element-binding protein 1 OS=Mus musculus OX=10090 GN=Srebf1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15133 TASL	2.6e-116	400.2	TLR adaptor interacting with SLC15A4 on the lysosome

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368245

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266771	0.838	Solute carrier family 15 member 4
2	9606.ENSP00000370034	0.561	Toll-like receptor 7
3	9606.ENSP00000368264	0.530	Melanoma-associated antigen B1
4	9606.ENSP00000316598	0.519	Putative GTP-binding protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0009966	0.982	regulation of signal transduction
GO:0045089	0.981	positive regulation of innate immune response
GO:0009967	0.973	positive regulation of signal transduction
GO:0062207	0.965	regulation of pattern recognition receptor signaling pathway
GO:0062208	0.904	positive regulation of pattern recognition receptor signaling pathway
GO:0039531	0.898	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0042592	0.598	homeostatic process
GO:0019725	0.547	cellular homeostasis
GO:0007040	0.531	lysosome organization
GO:0019222	0.514	regulation of metabolic process
GO:0055080	0.510	monoatomic cation homeostasis
GO:0006885	0.504	regulation of pH
GO:0006873	0.480	intracellular monoatomic ion homeostasis
GO:0030003	0.473	intracellular monoatomic cation homeostasis
GO:0034161	0.362	positive regulation of toll-like receptor 8 signaling pathway
GO:0034157	0.362	positive regulation of toll-like receptor 7 signaling pathway
GO:0065008	0.312	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0036020	0.996	endolysosome membrane
GO:0005886	0.940	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]