StarFunc result for job id Q9HAK2

User Input

>input (575 residues)
MFGIQDTLGRGPTLKEKSLGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSN
LRKSNFFHFVLALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVR
TEQDLYVRLIDSVTKQPIAYEGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPV
IIDRFFLKFFLKCNQNCLKTAGNPRDMRRFQVVLSTTVNVDGHVLAVSDNMFVHNNSKHG
RRARRLDPSEATPCIKAISPSEGWTTGGAMVIIIGDNFFDGLQVVFGTMLVWSELITPHA
IRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRLQKVIPRHPGD
PERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRNPSQLPALSSSPA
HSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISPRGYSSSSTPQQSNYSTSSNSMN
GYSNVPMANLGVPGSPGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPFSSSVFPAVKQKS
AFAPVIRPQGSPSPACSSGNGNGFRAMTGLVVPPM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08792	0.711	0.711	6.956E-98	575	0.995	0.995	O08792.pdb.gz	COE2_MOUSE Transcription factor COE2 OS=Mus musculus OX=10090 GN=Ebf2 PE=1 SV=4
2	AFDB:Q9BQW3	0.651	0.623	6.244E-81	602	0.718	0.686	Q9BQW3.pdb.gz	COE4_HUMAN Transcription factor COE4 OS=Homo sapiens OX=9606 GN=EBF4 PE=1 SV=2
3	AFDB:Q93705	0.591	0.690	2.210E-58	491	0.440	0.515	Q93705.pdb.gz	UNC3_CAEEL Transcription factor unc-3 OS=Caenorhabditis elegans OX=6239 GN=unc-3 PE=1 SV=3
4	AFDB:D4A0I8	0.141	0.093	6.040E-9	931	0.148	0.091	D4A0I8.pdb.gz	D4A0I8_RAT Nuclear factor of activated T-cells 2 OS=Rattus norvegicus OX=10116 GN=Nfatc2 PE=1 SV=1
5	AFDB:A0A0G2JTY4	0.136	0.078	1.528E-8	1076	0.167	0.089	A0A0G2JTY4.pdb.gz	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1
6	AFDB:O75022	0.127	0.117	1.285E-7	631	0.106	0.097	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
7	AFDB:P15307	0.154	0.151	3.250E-7	587	0.125	0.123	P15307.pdb.gz	REL_MOUSE Proto-oncogene c-Rel OS=Mus musculus OX=10090 GN=Rel PE=1 SV=2
8	AFDB:Q8NHL6	0.119	0.108	4.510E-7	650	0.090	0.080	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
9	PDB:6vxkB	0.123	0.096	9.052E-7	747	0.054	0.041	6vxkB.pdb.gz
10	AFDB:Q91XZ0	0.116	0.079	2.733E-6	931	0.111	0.069	Q91XZ0.pdb.gz	Q91XZ0_MOUSE Protocadherin gamma A1 OS=Mus musculus OX=10090 GN=Pcdhga1 PE=1 SV=1
11	AFDB:Q91XX1	0.117	0.083	4.467E-6	934	0.130	0.080	Q91XX1.pdb.gz	Q91XX1_MOUSE Protocadherin gamma C3 OS=Mus musculus OX=10090 GN=Pcdhgc3 PE=1 SV=1
12	PDB:4aq1A	0.096	0.079	2.822E-5	721	0.052	0.042	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:4rtdA	0.089	0.051	8.328E-4	1122	0.078	0.040	4rtdA.pdb.gz
14	PDB:7fabH	0.115	0.240	9.289E-4	209	0.042	0.115	7fabH.pdb.gz
15	PDB:7tvzE	0.102	0.092	1.289E-3	665	0.057	0.050	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
16	PDB:5e7gA	0.141	0.171	1.995E-3	446	0.059	0.076	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
17	PDB:5a42A	0.099	0.041	2.482E-3	1597	0.087	0.031	5a42A.pdb.gz
18	PDB:3bn9F	0.103	0.224	2.621E-3	224	0.030	0.076	3bn9F.pdb.gz
19	PDB:6feyB	0.098	0.218	2.924E-3	207	0.049	0.135	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
20	PDB:4jmxA	0.090	0.189	3.637E-3	216	0.019	0.051	4jmxA.pdb.gz	Structures of free and inhibited forms of the L,D-transpeptidase LdtMt1 from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08791	0.0	996	596	0.840	0.810	COE3_MOUSE Transcription factor COE3 OS=Mus musculus OX=10090 GN=Ebf3 PE=1 SV=1
2	O08792	0.0	1187	575	0.995	0.995	COE2_MOUSE Transcription factor COE2 OS=Mus musculus OX=10090 GN=Ebf2 PE=1 SV=4
3	P56721	0.0	641	575	0.598	0.598	COLL_DROME Transcription factor collier OS=Drosophila melanogaster OX=7227 GN=kn PE=2 SV=2
4	Q07802	0.0	953	591	0.786	0.765	COE1_MOUSE Transcription factor COE1 OS=Mus musculus OX=10090 GN=Ebf1 PE=1 SV=1
5	Q63398	0.0	956	584	0.786	0.774	COE1_RAT Transcription factor COE1 OS=Rattus norvegicus OX=10116 GN=Ebf1 PE=1 SV=2
6	Q8K4J2	0.0	818	599	0.713	0.684	COE4_MOUSE Transcription factor COE4 OS=Mus musculus OX=10090 GN=Ebf4 PE=2 SV=1
7	Q9BQW3	0.0	824	602	0.720	0.688	COE4_HUMAN Transcription factor COE4 OS=Homo sapiens OX=9606 GN=EBF4 PE=1 SV=2
8	Q9H4W6	0.0	994	596	0.838	0.809	COE3_HUMAN Transcription factor COE3 OS=Homo sapiens OX=9606 GN=EBF3 PE=1 SV=2
9	Q9HAK2	0.0	1192	575	1.000	1.000	COE2_HUMAN Transcription factor COE2 OS=Homo sapiens OX=9606 GN=EBF2 PE=1 SV=4
10	Q9UH73	0.0	953	591	0.786	0.765	COE1_HUMAN Transcription factor COE1 OS=Homo sapiens OX=9606 GN=EBF1 PE=1 SV=2
11	Q93705	5.16e-180	519	491	0.435	0.509	UNC3_CAEEL Transcription factor unc-3 OS=Caenorhabditis elegans OX=6239 GN=unc-3 PE=1 SV=3
12	O13987	0.002	43.9	1151	0.054	0.027	YEG5_SCHPO Ankyrin and IPT/TIG repeat-containing protein C26H5.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.05 PE=4 SV=1
13	P40578	0.012	41.2	1113	0.047	0.024	MGA2_YEAST Protein MGA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGA2 PE=1 SV=1
14	A0A1D8PIM6	0.028	39.7	742	0.050	0.039	A0A1D8PIM6_CANAL Spt23p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SPT23 PE=4 SV=1
15	P34474	0.10	37.7	431	0.033	0.044	HLH11_CAEEL Helix-loop-helix protein 11 OS=Caenorhabditis elegans OX=6239 GN=hlh-11 PE=1 SV=3
16	P35210	0.32	36.6	1082	0.038	0.020	SPT23_YEAST Protein SPT23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT23 PE=1 SV=2
17	F1Q7U0	2.8	33.5	2220	0.043	0.011	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
18	A0A096LNR9	2.9	33.5	784	0.038	0.028	A0A096LNR9_HUMAN Cyclin dependent kinase like 5 (Fragment) OS=Homo sapiens OX=9606 GN=CDKL5 PE=1 SV=1
19	A0A1B0GUM4	3.0	33.5	881	0.038	0.025	A0A1B0GUM4_HUMAN Cyclin dependent kinase like 5 OS=Homo sapiens OX=9606 GN=CDKL5 PE=1 SV=1
20	O08679	4.4	32.7	722	0.056	0.044	MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus OX=10116 GN=Mark2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16422 COE1_DBD	7.9e-140	475.6	Transcription factor COE1 DNA-binding domain
2	PF16423 COE1_HLH	1e-30	116.6	Transcription factor COE1 helix-loop-helix domain
3	PF01833 TIG	2.2e-08	45.4	IPT/TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000430241

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287820	0.895	Peroxisome proliferator-activated receptor gamma
2	9606.ENSP00000270722	0.768	PR domain zinc finger protein 16
3	9606.ENSP00000442046	0.755	Transmembrane and tetratricopeptide repeat containing 1
4	9606.ENSP00000455426	0.742	Zinc finger protein 423
5	9606.ENSP00000310275	0.683	Barrier-to-autointegration factor
6	9606.ENSP00000334051	0.655	Guanine nucleotide-binding protein G(olf) subunit alpha
7	9606.ENSP00000262999	0.641	Mitochondrial brown fat uncoupling protein 1
8	9606.ENSP00000347924	0.614	Sideroflexin-4
9	9606.ENSP00000261731	0.613	LIM/homeobox protein Lhx5
10	9606.ENSP00000479526	0.605	Zinc finger protein DPF3
11	9606.ENSP00000344242	0.597	Leucine-rich repeat-containing protein 17
12	9606.ENSP00000365280	0.576	DNA-binding protein inhibitor ID-1
13	9606.ENSP00000307023	0.571	Krueppel-like factor 11
14	9606.ENSP00000320209	0.560	Cell death activator CIDE-A
15	9606.ENSP00000228644	0.555	Myogenic factor 5
16	9606.ENSP00000452871	0.540	Transducin-like enhancer protein 3
17	9606.ENSP00000297350	0.535	Tumor necrosis factor receptor superfamily member 11B
18	9606.ENSP00000283179	0.524	Heterogeneous nuclear ribonucleoprotein U
19	9606.ENSP00000394757	0.522	Zinc finger protein 516
20	9606.ENSP00000417980	0.513	Histone-lysine N-methyltransferase EHMT1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.963	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003682	0.861	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0010468	0.978	regulation of gene expression
GO:0006357	0.959	regulation of transcription by RNA polymerase II
GO:0048518	0.905	positive regulation of biological process
GO:0045944	0.900	positive regulation of transcription by RNA polymerase II
GO:0009987	0.832	cellular process
GO:0032502	0.458	developmental process
GO:0048856	0.330	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.987	nuclear lumen
GO:0005654	0.983	nucleoplasm
GO:0005737	0.730	cytoplasm
GO:0043232	0.369	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]