StarFunc result for job id Q9HAN9

User Input

>input (279 residues)
MENSEKTEVVLLACGSFNPITNMHLRLFELAKDYMNGTGRYTVVKGIISPVGDAYKKKGL
IPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTL
ERPGRKRKWTETQDSSQKKSLEPKTKAVPKVKLLCGADLLESFAVPNLWKSEDITQIVAN
YGLICVTRAGNDAQKFIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLV
PDLVQEYIEKHNLYSSESEDRNAGVILAPLQRNTAEAKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4E1	0.977	0.977	2.225E-56	279	1.000	1.000	A0A024R4E1.pdb.gz
2	AFDB:A0JPJ0	0.884	0.865	8.107E-49	285	0.828	0.811	A0JPJ0.pdb.gz	A0JPJ0_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
3	PDB:1kqoA	0.819	0.978	1.707E-43	233	0.828	0.991	1kqoA.pdb.gz	Structure of Hhuman of Nicotinamide/Nicotinic Acid Mononucleotide Adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.
4	AFDB:Q96T66	0.759	0.839	1.763E-34	252	0.452	0.500	Q96T66.pdb.gz	NMNA3_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Homo sapiens OX=9606 GN=NMNAT3 PE=1 SV=2
5	AFDB:F7F588	0.788	0.895	2.262E-34	245	0.437	0.498	F7F588.pdb.gz	F7F588_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat3 PE=1 SV=1
6	PDB:1nupA	0.749	0.978	5.328E-31	213	0.430	0.563	1nupA.pdb.gz	STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
7	AFDB:Q9VC03	0.776	0.559	9.162E-30	389	0.398	0.285	Q9VC03.pdb.gz	Q9VC03_DROME Nicotinamide-nucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Nmnat PE=1 SV=4
8	PDB:5z9rB	0.747	0.950	7.017E-27	218	0.412	0.528	5z9rB.pdb.gz
9	AFDB:Q0HA29	0.759	0.692	8.775E-27	307	0.380	0.345	Q0HA29.pdb.gz	NMNA2_RAT Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Nmnat2 PE=2 SV=1
10	AFDB:Q9UT53	0.760	0.580	1.367E-25	368	0.366	0.277	Q9UT53.pdb.gz	NMAH_SCHPO Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC806.06c PE=1 SV=2
11	AFDB:Q06178	0.753	0.527	3.710E-25	401	0.358	0.249	Q06178.pdb.gz	NMA1_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMA1 PE=1 SV=1
12	AFDB:P53204	0.759	0.539	1.007E-24	395	0.369	0.261	P53204.pdb.gz	NMA2_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMA2 PE=1 SV=1
13	AFDB:F4K688	0.660	0.697	1.493E-21	264	0.297	0.314	F4K688.pdb.gz	F4K688_ARATH Nicotinate/nicotinamide mononucleotide adenyltransferase OS=Arabidopsis thaliana OX=3702 GN=NMNAT PE=1 SV=1
14	PDB:1k4mA	0.597	0.768	2.692E-11	213	0.176	0.230	1k4mA.pdb.gz	Crystal structures of E. coli nicotinate mononucleotide adenylyltransferase and its complex with deamido-NAD.
15	PDB:5lltA	0.552	0.728	3.089E-9	205	0.168	0.229	5lltA.pdb.gz	Structural and Functional Characterization of Plasmodium falciparum Nicotinic Acid Mononucleotide Adenylyltransferase.
16	PDB:6cckB	0.417	0.670	2.470E-5	160	0.140	0.244	6cckB.pdb.gz	Fragment-Based Drug Discovery of Inhibitors of Phosphopantetheine Adenylyltransferase from Gram-Negative Bacteria.
17	PDB:3nbkD	0.411	0.646	1.175E-4	163	0.115	0.196	3nbkD.pdb.gz	Kinetic, thermodynamic, and structural insight into the mechanism of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis.
18	PDB:2qjoB	0.378	0.327	4.359E-4	336	0.147	0.122	2qjoB.pdb.gz	Bifunctional NMN Adenylyltransferase/ADP-Ribose Pyrophosphatase: Structure and Function in Bacterial NAD Metabolism.
19	PDB:5h75D	0.243	0.282	3.872E-3	225	0.075	0.093	5h75D.pdb.gz	Construction of novel repeat proteins with rigid and predictable structures using a shared helix method.
20	PDB:4i72A	0.189	0.173	5.002E-2	328	0.151	0.128	4i72A.pdb.gz	Structures of purine nucleosidase from Trypanosoma brucei bound to isozyme-specific trypanocidals and a novel metalorganic inhibitor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HAN9	0.0	580	279	1.000	1.000	NMNA1_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Homo sapiens OX=9606 GN=NMNAT1 PE=1 SV=1
2	A0JPJ0	2.30e-175	486	285	0.828	0.811	A0JPJ0_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
3	A0A8I5ZV91	5.49e-175	487	316	0.828	0.731	A0A8I5ZV91_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
4	Q9EPA7	6.29e-175	485	285	0.821	0.804	NMNA1_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Mus musculus OX=10090 GN=Nmnat1 PE=1 SV=2
5	A0A8I5ZK56	1.14e-174	486	306	0.828	0.755	A0A8I5ZK56_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
6	A0A8J8Y7I4	4.83e-170	474	302	0.828	0.765	A0A8J8Y7I4_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
7	A0A8I6ANE3	8.19e-170	473	306	0.821	0.748	A0A8I6ANE3_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
8	B1AN62	8.16e-106	306	160	0.523	0.912	B1AN62_HUMAN Nicotinamide nucleotide adenylyltransferase 1 OS=Homo sapiens OX=9606 GN=NMNAT1 PE=1 SV=1
9	Q96T66	1.22e-87	263	252	0.459	0.508	NMNA3_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Homo sapiens OX=9606 GN=NMNAT3 PE=1 SV=2
10	F7F588	1.24e-83	253	245	0.423	0.482	F7F588_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat3 PE=1 SV=1
11	Q99JR6	1.49e-83	252	245	0.437	0.498	NMNA3_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Mus musculus OX=10090 GN=Nmnat3 PE=1 SV=1
12	Q8T405	6.71e-73	226	266	0.416	0.436	Q8T405_DROME Nicotinamide-nucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Nmnat PE=1 SV=1
13	Q7KS06	2.27e-72	226	297	0.416	0.391	Q7KS06_DROME Nicotinamide-nucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Nmnat PE=1 SV=1
14	A0A0B4KHH7	3.49e-71	224	358	0.409	0.318	A0A0B4KHH7_DROME Nicotinamide-nucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Nmnat PE=1 SV=1
15	Q9VC03	8.58e-71	224	389	0.409	0.293	Q9VC03_DROME Nicotinamide-nucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Nmnat PE=1 SV=4
16	P53204	1.11e-67	217	395	0.387	0.273	NMA2_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMA2 PE=1 SV=1
17	Q06178	4.96e-63	205	401	0.376	0.262	NMA1_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMA1 PE=1 SV=1
18	Q9UT53	3.67e-60	197	368	0.366	0.277	NMAH_SCHPO Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC806.06c PE=1 SV=2
19	Q0HA29	1.30e-57	188	307	0.387	0.352	NMNA2_RAT Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Nmnat2 PE=2 SV=1
20	Q8BNJ3	6.47e-57	186	307	0.384	0.349	NMNA2_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Mus musculus OX=10090 GN=Nmnat2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01467 CTP_transf_like	1.6e-26	104.7	Cytidylyltransferase-like
2	PF18936 DUF5684	2.1e+02	14.0	Family of unknown function (DUF5684)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366410

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222553	0.981	Nicotinamide phosphoribosyltransferase
2	9606.ENSP00000354387	0.981	Nicotinamide riboside kinase 1
3	9606.ENSP00000401508	0.981	Nicotinate phosphoribosyltransferase
4	9606.ENSP00000326424	0.977	Glutamine-dependent NAD(+) synthetase
5	9606.ENSP00000212015	0.975	NAD-dependent protein deacetylase sirtuin-1
6	9606.ENSP00000378782	0.971	Nicotinate-nucleotide pyrophosphorylase [carboxylating]
7	9606.ENSP00000480091	0.956	Nicotinamide riboside kinase 2
8	9606.ENSP00000265016	0.949	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
9	9606.ENSP00000226279	0.942	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
10	9606.ENSP00000264663	0.927	NAD(P) transhydrogenase, mitochondrial
11	9606.ENSP00000343001	0.922	Ubiquitin conjugation factor E4 B
12	9606.ENSP00000371362	0.915	NAD kinase 2, mitochondrial
13	9606.ENSP00000230792	0.892	Peroxisomal NADH pyrophosphatase NUDT12
14	9606.ENSP00000476228	0.885	NAD-dependent protein deacylase sirtuin-5, mitochondrial
15	9606.ENSP00000202967	0.872	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
16	9606.ENSP00000249396	0.872	NAD-dependent protein deacetylase sirtuin-2
17	9606.ENSP00000329466	0.872	NAD-dependent protein deacetylase sirtuin-7
18	9606.ENSP00000372191	0.867	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
19	9606.ENSP00000337332	0.862	NAD-dependent protein deacetylase sirtuin-6
20	9606.ENSP00000468032	0.834	Sterile alpha and TIR motif-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000309	1.000	nicotinamide-nucleotide adenylyltransferase activity
GO:0005515	0.998	protein binding
GO:0004515	0.849	nicotinate-nucleotide adenylyltransferase activity
GO:0042802	0.821	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0008152	0.995	metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:1901564	0.989	organonitrogen compound metabolic process
GO:0046483	0.975	heterocycle metabolic process
GO:0006139	0.965	nucleobase-containing compound metabolic process
GO:0055086	0.955	nucleobase-containing small molecule metabolic process
GO:0006163	0.949	purine nucleotide metabolic process
GO:0034654	0.948	nucleobase-containing compound biosynthetic process
GO:0009165	0.939	nucleotide biosynthetic process
GO:1901135	0.618	carbohydrate derivative metabolic process
GO:0065007	0.593	biological regulation
GO:0019693	0.587	ribose phosphate metabolic process
GO:0009259	0.558	ribonucleotide metabolic process
GO:0043170	0.555	macromolecule metabolic process
GO:0009141	0.550	nucleoside triphosphate metabolic process
GO:0050789	0.538	regulation of biological process
GO:0009199	0.525	ribonucleoside triphosphate metabolic process
GO:0009144	0.516	purine nucleoside triphosphate metabolic process
GO:0009205	0.482	purine ribonucleoside triphosphate metabolic process
GO:0050794	0.468	regulation of cellular process
GO:0019222	0.387	regulation of metabolic process
GO:0050896	0.377	response to stimulus
GO:0009150	0.356	purine ribonucleotide metabolic process
GO:0080090	0.324	regulation of primary metabolic process
GO:0031323	0.308	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.988	intracellular organelle lumen
GO:0005654	0.949	nucleoplasm
GO:0005737	0.845	cytoplasm
GO:0016604	0.683	nuclear body
GO:0005829	0.338	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21360	1.000	ATP + beta-nicotinamide D-ribonucleotide + H(+) = diphosphate + NAD(+)
EC:2.7.7.1	1.000	nicotinamide-nucleotide adenylyltransferase.
RHEA:22860	0.849	ATP + H(+) + nicotinate beta-D-ribonucleotide = deamido-NAD(+) + diphosphate
EC:2.7.7.18	0.849	nicotinate-nucleotide adenylyltransferase.

[back to server]