StarFunc result for job id Q9HAP2

User Input

>input (919 residues)
MAADVFMCSPRRPRSRGRQVLLKPQVSEDDDDSDTDEPSPPPASGAATPARAHASAAPPP
PRAGPGREEPPRRQQIIHSGHFMVSSPHREHPPKKGYDFDTVNKQTCQTYSFGKTSSCHL
SIDASLTKLFECMTLAYSGKLVSPKWKNFKGLKLQWRDKIRLNNAIWRAWYMQYLEKRKN
PVCHFVTPLDGSVDVDEHRRPEAITTEGKYWKSRIEIVIREYHKWRTYFKKRLQQHKDED
LSSLVQDDDMLYWHKHGDGWKTPVPMEEDPLLDTDMLMSEFSDTLFSTLSSHQPVAWPNP
REIAHLGNADMIQPGLIPLQPNLDFMDTFEPFQDLFSSSRSIFGSMLPASASAPVPDPNN
PPAQESILPTTALPTVSLPDSLIAPPTAPSLAHMDEQGCEHTSRTEDPFIQPTDFGPSEP
PLSVPQPFLPVFTMPLLSPSPAPPPISPVLPLVPPPATALNPPAPPTFHQPQKFAGVNKA
PSVITHTASATLTHDAPATTFSQSQGLVITTHHPAPSAAPCGLALSPVTRPPQPRLTFVH
PKPVSLTGGRPKQPHKIVPAPKPEPVSLVLKNARIAPAAFSGQPQAVIMTSGPLKREGML
ASTVSQSNVVIAPAAIARAPGVPEFHSSILVTDLGHGTSSPPAPVSRLFPSTAQDPLGKG
EQVPLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQSPQNNCSGKSDPKNVAALKNR
QMKHISAEQKRRFNIKMCFDMLNSLISNNSKLTSHAITLQKTVEYITKLQQERGQMQEEA
RRLREEIEELNATIISCQQLLPATGVPVTRRQFDHMKDMFDEYVKTRTLQNWKFWIFSII
IKPLFESFKGMVSTSSLEELHRTALSWLDQHCSLPILRPMVLSTLRQLSTSTSILTDPAQ
LPEQASKAVTRIGKRLGES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAP2	1.000	1.000	0.000	919	1.000	1.000	Q9HAP2.pdb.gz	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
2	AFDB:Q2VPU4	0.220	0.220	7.915E-104	917	0.864	0.866	Q2VPU4.pdb.gz	MLXIP_MOUSE MLX-interacting protein OS=Mus musculus OX=10090 GN=Mlxip PE=1 SV=1
3	AFDB:Q9NP71	0.121	0.130	4.494E-45	852	0.398	0.430	Q9NP71.pdb.gz	MLXPL_HUMAN Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
4	AFDB:Q9BKE5	0.158	0.141	8.669E-35	1062	0.288	0.250	Q9BKE5.pdb.gz	Q9BKE5_DROME Mlx interactor beta OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
5	AFDB:P41846	0.114	0.106	1.172E-24	1009	0.258	0.235	P41846.pdb.gz	WBS14_CAEEL Protein WBSCR14 homolog OS=Caenorhabditis elegans OX=6239 GN=mml-1 PE=1 SV=2
6	AFDB:B9G5N1	0.059	0.061	4.111E-4	844	0.140	0.153	B9G5N1.pdb.gz	PAIR3_ORYSJ Meiosis-specific protein PAIR3 OS=Oryza sativa subsp. japonica OX=39947 GN=PAIR3 PE=2 SV=1
7	AFDB:O95197	0.056	0.051	8.875E-4	1032	0.139	0.124	O95197.pdb.gz	RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2
8	AFDB:Q9VQM0	0.055	0.031	1.425E-3	2162	0.165	0.070	Q9VQM0.pdb.gz	Q9VQM0_DROME Toucan, isoform A OS=Drosophila melanogaster OX=7227 GN=toc PE=4 SV=2
9	AFDB:Q7SZL5	0.065	0.047	1.512E-3	1338	0.157	0.108	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
10	AFDB:Q9R0G8	0.049	0.034	2.289E-3	1455	0.113	0.071	Q9R0G8.pdb.gz	NRK_MOUSE Nik-related protein kinase OS=Mus musculus OX=10090 GN=Nrk PE=1 SV=2
11	PDB:7mq8LJ	0.055	0.095	2.445	469	0.018	0.036	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6n3qF	0.041	0.137	3.099	190	0.027	0.132	6n3qF.pdb.gz
13	PDB:7nacm	0.046	0.056	3.099	666	0.049	0.068	7nacm.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
14	PDB:6elzm	0.042	0.056	3.288	645	0.044	0.062	6elzm.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
15	PDB:2p22C	0.062	0.229	3.488	186	0.036	0.177	2p22C.pdb.gz
16	PDB:7dvqR	0.046	0.106	4.421	241	0.032	0.120	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:6yxxAN	0.037	0.126	4.976	193	0.023	0.109	6yxxAN.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:1zvuA	0.041	0.050	6.306	685	0.017	0.023	1zvuA.pdb.gz
19	PDB:2aczC	0.037	0.151	6.306	129	0.015	0.109	2aczC.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
20	PDB:2v6l0	0.033	0.205	6.306	82	0.020	0.220	2v6l0.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2VPU4	0.0	1546	917	0.871	0.872	MLXIP_MOUSE MLX-interacting protein OS=Mus musculus OX=10090 GN=Mlxip PE=1 SV=1
2	Q9HAP2	0.0	1880	919	1.000	1.000	MLXIP_HUMAN MLX-interacting protein OS=Homo sapiens OX=9606 GN=MLXIP PE=1 SV=2
3	Q8VIP2	4.05e-80	280	865	0.146	0.155	MLXPL_RAT Carbohydrate-responsive element-binding protein OS=Rattus norvegicus OX=10116 GN=Mlxipl PE=1 SV=1
4	Q99MZ3	1.56e-79	278	864	0.145	0.154	MLXPL_MOUSE Carbohydrate-responsive element-binding protein OS=Mus musculus OX=10090 GN=Mlxipl PE=1 SV=1
5	Q9NP71	4.27e-79	276	852	0.146	0.157	MLXPL_HUMAN Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
6	A0A0C4DG26	4.54e-65	234	721	0.119	0.151	A0A0C4DG26_HUMAN HCG18989, isoform CRA_h OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
7	Q9VID4	4.15e-49	191	1119	0.110	0.090	Q9VID4_DROME LD38259p OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=2
8	Q9BKE5	5.98e-49	191	1062	0.110	0.095	Q9BKE5_DROME Mlx interactor beta OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
9	Q9BKE4	3.14e-45	177	836	0.096	0.105	Q9BKE4_DROME Mlx interactor gamma OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
10	Q8INT6	1.15e-44	176	925	0.096	0.095	Q8INT6_DROME FI20159p1 OS=Drosophila melanogaster OX=7227 GN=Mondo PE=2 SV=1
11	P41846	2.90e-36	150	1009	0.106	0.096	WBS14_CAEEL Protein WBSCR14 homolog OS=Caenorhabditis elegans OX=6239 GN=mml-1 PE=1 SV=2
12	O08609	1.31e-15	80.9	298	0.061	0.188	MLX_MOUSE Max-like protein X OS=Mus musculus OX=10090 GN=Mlx PE=1 SV=1
13	Q9UH92	1.54e-15	80.5	298	0.061	0.188	MLX_HUMAN Max-like protein X OS=Homo sapiens OX=9606 GN=MLX PE=1 SV=2
14	Q9VB47	5.23e-12	69.3	254	0.054	0.197	Q9VB47_DROME Bigmax OS=Drosophila melanogaster OX=7227 GN=bigmax PE=2 SV=1
15	Q9GQP6	2.50e-11	67.4	254	0.055	0.201	Q9GQP6_DROME BHLHZip transcription factor BIGMAX OS=Drosophila melanogaster OX=7227 GN=bigmax PE=2 SV=1
16	Q561Z2	0.001	45.1	539	0.044	0.074	Q561Z2_DANRE Tfe3a protein OS=Danio rerio OX=7955 GN=cb873 PE=2 SV=1
17	A2AEW1	0.003	43.9	572	0.046	0.073	A2AEW1_MOUSE Transcription factor E3 OS=Mus musculus OX=10090 GN=Tfe3 PE=1 SV=1
18	Q64092	0.003	43.9	572	0.046	0.073	TFE3_MOUSE Transcription factor E3 OS=Mus musculus OX=10090 GN=Tfe3 PE=1 SV=2
19	M9PC48	0.007	43.1	18095	0.064	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	P19532	0.010	42.0	575	0.045	0.071	TFE3_HUMAN Transcription factor E3 OS=Homo sapiens OX=9606 GN=TFE3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	36	16.0	Autophagy protein 16 (ATG16)
2	PF04977 DivIC	5.1e+02	11.8	Septum formation initiator
3	PF19908 DUF6381	2.8e+02	12.7	Family of unknown function (DUF6381)
4	PF20379 DUF6674	67	14.5	Family of unknown function (DUF6674)
5	PF00010 HLH	1.5e-05	36.2	Helix-loop-helix DNA-binding domain
6	PF05659 RPW8	1.1e+02	13.9	Arabidopsis broad-spectrum mildew resistance protein RPW8
7	PF00992 Troponin	8e+02	11.7	Troponin
8	PF06005 ZapB	5.1	19.0	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312834

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246912	0.991	Max-like protein X
2	9606.ENSP00000362824	0.846	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
3	9606.ENSP00000320886	0.820	Carbohydrate-responsive element-binding protein
4	9606.ENSP00000312649	0.804	Peroxisome proliferator-activated receptor gamma coactivator 1-beta
5	9606.ENSP00000337889	0.800	Max dimerization protein 4
6	9606.ENSP00000462521	0.734	Thioredoxin-interacting protein
7	9606.ENSP00000466799	0.720	Estradiol 17-beta-dehydrogenase 1
8	9606.ENSP00000264444	0.717	Max dimerization protein 1
9	9606.ENSP00000174618	0.657	Max-binding protein MNT
10	9606.ENSP00000401867	0.655	Max dimerization protein 3
11	9606.ENSP00000384863	0.650	Exportin-1
12	9606.ENSP00000268042	0.644	Arrestin domain-containing protein 4
13	9606.ENSP00000253047	0.622	Transmembrane protein 160
14	9606.ENSP00000354558	0.621	Serine/threonine-protein kinase mTOR
15	9606.ENSP00000338629	0.592	Arginine-glutamic acid dipeptide repeats protein
16	9606.ENSP00000378402	0.559	Paired amphipathic helix protein Sin3a
17	9606.ENSP00000301149	0.505	Glycerol-3-phosphate dehydrogenase 1
18	9606.ENSP00000306003	0.502	ATP synthase subunit e, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.996	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019222	0.994	regulation of metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0080090	0.983	regulation of primary metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0031323	0.983	regulation of cellular metabolic process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0048518	0.976	positive regulation of biological process
GO:0009889	0.967	regulation of biosynthetic process
GO:0010556	0.956	regulation of macromolecule biosynthetic process
GO:0031326	0.956	regulation of cellular biosynthetic process
GO:0010468	0.955	regulation of gene expression
GO:0031325	0.950	positive regulation of cellular metabolic process
GO:0006357	0.949	regulation of transcription by RNA polymerase II
GO:0051173	0.943	positive regulation of nitrogen compound metabolic process
GO:0009987	0.925	cellular process
GO:0009891	0.924	positive regulation of biosynthetic process
GO:0045935	0.921	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.908	positive regulation of macromolecule metabolic process
GO:0031328	0.900	positive regulation of cellular biosynthetic process
GO:0045944	0.889	positive regulation of transcription by RNA polymerase II
GO:0048519	0.393	negative regulation of biological process
GO:0009892	0.326	negative regulation of metabolic process
GO:0050896	0.313	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.947	intracellular organelle lumen
GO:0031981	0.926	nuclear lumen
GO:0005654	0.914	nucleoplasm
GO:0005829	0.879	cytosol
GO:0032991	0.319	protein-containing complex
GO:0012505	0.317	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]