StarFunc result for job id Q9HAR2

User Input

>input (1447 residues)
MWPSQLLIFMMLLAPIIHAFSRAPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGR
TDDKICDSDPAQMENIRCYLPDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQ
YECVPYKVEQKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTD
TLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSG
EAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGT
WDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNS
YQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGQAHHGQVSYISPPIHLDSELE
RPSVKDISTTGPLGMGSTTTSTTLRTTTLSPGRSTTPSVSGRRNRSTSTPSPAVEVLDDM
TTHLPSASSQIPALEESCEAVEAREIMWFKTRQGQIAKQPCPAGTIGVSTYLCLAPDGIW
DPQGPDLSNCSSPWVNHITQKLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVG
LLDVQLRNLTPGGKDSAARSLNKAMVETVNNLLQPQALNAWRDLTTSDQLRAATMLLHTV
EESAFVLADNLLKTDIVRENTDNIKLEVARLSTEGNLEDLKFPENMGHGSTIQLSANTLK
QNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEALSTNHSVIVNSPVITAAINKEFSNK
VYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTCSCNH
LTNFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNTIH
KNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVEVF
ESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLIIM
LNVIFLGIALYKMFHHTAILKPESGCLDNIKSWVIGAIALLCLLGLTWAFGLMYINESTV
IMAYLFTIFNSLQGMFIFIFHCVLQKKVRKEYGKCLRTHCCSGKSTESSIGSGKTSGSRT
PGRYSTGSQSRIRRMWNDTVRKQSESSFITGDINSSASLNREGLLNNARDTSVMDTLPLN
GNHGNSYSIASGEYLSNCVQIIDRGYNHNETALEKKILKELTSNYIPSYLNNHERSSEQN
RNLMNKLVNNLGSGREDDAIVLDDATSFNHEESLGLELIHEESDAPLLPPRVYSTENHQP
HHYTRRRIPQDHSESFFPLLTNEHTEDLQSPHRDSLYTSMPTLAGVAATESVTTSTQTEP
PPAKCGDAEDVYYKSMPNLGSRNHVHQLHTYYQLGRGSSDGFIVPPNKDGTPPEGSSKGP
AHLVTSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QM07	0.466	0.443	0.000	1540	0.745	0.700	A0A2R8QM07.pdb.gz	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
2	AFDB:O88917	0.451	0.432	0.000	1515	0.543	0.519	O88917.pdb.gz	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
3	AFDB:O88923	0.408	0.399	0.000	1487	0.601	0.585	O88923.pdb.gz	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
4	AFDB:O94910	0.403	0.397	0.000	1474	0.551	0.541	O94910.pdb.gz	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
5	AFDB:O95490	0.434	0.431	0.000	1459	0.601	0.596	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
6	AFDB:Q9HAR2	0.999	0.999	0.000	1447	1.000	1.000	Q9HAR2.pdb.gz	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
7	AFDB:Q9Z173	0.447	0.420	0.000	1550	0.948	0.885	Q9Z173.pdb.gz	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
8	AFDB:O14514	0.227	0.210	2.411E-39	1584	0.185	0.169	O14514.pdb.gz	AGRB1_HUMAN Adhesion G protein-coupled receptor B1 OS=Homo sapiens OX=9606 GN=ADGRB1 PE=1 SV=2
9	AFDB:E7FBY6	0.172	0.180	3.624E-32	1367	0.132	0.140	E7FBY6.pdb.gz	AGRA2_DANRE Adhesion G protein-coupled receptor A2 OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=2
10	AFDB:Q96PE1	0.173	0.185	3.165E-31	1338	0.125	0.135	Q96PE1.pdb.gz	AGRA2_HUMAN Adhesion G protein-coupled receptor A2 OS=Homo sapiens OX=9606 GN=ADGRA2 PE=1 SV=2
11	PDB:5amoB	0.163	0.887	8.176E-23	257	0.073	0.409	5amoB.pdb.gz
12	PDB:7d3sR	0.156	0.744	1.687E-9	266	0.048	0.263	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
13	PDB:7tynR	0.158	0.556	3.979E-9	373	0.041	0.158	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
14	PDB:4k5yC	0.146	0.759	4.355E-9	248	0.046	0.266	4k5yC.pdb.gz	Structure of class B GPCR corticotropin-releasing factor receptor 1.
15	PDB:7vqxR	0.152	0.560	4.355E-9	361	0.043	0.172	7vqxR.pdb.gz	A distinctive ligand recognition mechanism by the human vasoactive intestinal polypeptide receptor 2.
16	PDB:7lciR	0.163	0.534	5.974E-9	393	0.053	0.196	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
17	PDB:7durR	0.156	0.559	1.409E-8	371	0.044	0.170	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
18	PDB:7cz5R	0.156	0.734	1.542E-8	269	0.046	0.245	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
19	PDB:7finR	0.161	0.558	2.115E-8	380	0.052	0.197	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
20	PDB:6vn7R	0.149	0.729	7.157E-8	263	0.046	0.251	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Q6E9	0.0	2115	1492	0.747	0.725	A0A2R8Q6E9_DANRE Adhesion G protein-coupled receptor L3 isoform X5 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
2	A0A2R8QM07	0.0	2092	1540	0.746	0.701	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
3	F1Q579	0.0	2095	1534	0.747	0.705	F1Q579_DANRE Adhesion G protein-coupled receptor L3 isoform X3 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=3
4	O88917	0.0	1540	1515	0.549	0.525	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
5	O88923	0.0	1720	1487	0.611	0.594	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
6	O94910	0.0	1552	1474	0.552	0.542	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1
7	O95490	0.0	1749	1459	0.610	0.605	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
8	Q80TR1	0.0	1542	1466	0.547	0.540	AGRL1_MOUSE Adhesion G protein-coupled receptor L1 OS=Mus musculus OX=10090 GN=Adgrl1 PE=1 SV=2
9	Q80TS3	0.0	2888	1537	0.960	0.904	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
10	Q8JZZ7	0.0	1731	1487	0.610	0.594	AGRL2_MOUSE Adhesion G protein-coupled receptor L2 OS=Mus musculus OX=10090 GN=Adgrl2 PE=1 SV=3
11	Q9HAR2	0.0	3025	1447	1.000	1.000	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
12	Q9Z173	0.0	2862	1550	0.956	0.893	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
13	Q9HBW9	1.38e-119	392	690	0.159	0.333	AGRL4_HUMAN Adhesion G protein-coupled receptor L4 OS=Homo sapiens OX=9606 GN=ADGRL4 PE=1 SV=3
14	Q9ESC1	1.63e-108	363	738	0.149	0.293	AGRL4_RAT Adhesion G protein-coupled receptor L4 OS=Rattus norvegicus OX=10116 GN=Adgrl4 PE=1 SV=1
15	G5EDW2	1.28e-90	320	1014	0.144	0.206	LPLT1_CAEEL Latrophilin-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=lat-1 PE=1 SV=1
16	G5ECX0	1.04e-78	288	1338	0.108	0.117	LPLT2_CAEEL Latrophilin-like protein LAT-2 OS=Caenorhabditis elegans OX=6239 GN=lat-2 PE=2 SV=1
17	Q61549	1.78e-77	279	931	0.116	0.180	AGRE1_MOUSE Adhesion G protein-coupled receptor E1 OS=Mus musculus OX=10090 GN=Adgre1 PE=1 SV=1
18	Q91ZE5	9.78e-77	271	689	0.122	0.255	AGRE4_MOUSE Adhesion G protein-coupled receptor E4 OS=Mus musculus OX=10090 GN=Adgre4 PE=1 SV=1
19	Q5Y4N8	1.23e-76	277	932	0.119	0.185	AGRE1_RAT Adhesion G protein-coupled receptor E2 OS=Rattus norvegicus OX=10116 GN=Adgre1 PE=2 SV=1
20	Q9BY15	5.22e-76	268	652	0.125	0.278	AGRE3_HUMAN Adhesion G protein-coupled receptor E3 OS=Homo sapiens OX=9606 GN=ADGRE3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	1.2e-68	242.6	7 transmembrane receptor (Secretin family)
2	PF05462 Dicty_CAR	1.2e+02	13.3	Slime mold cyclic AMP receptor
3	PF16489 GAIN	8e-49	177.4	GPCR-Autoproteolysis INducing (GAIN) domain
4	PF02140 Gal_Lectin	9.6e-20	82.1	Galactose binding lectin domain
5	PF01825 GPS	6.6e-11	54.0	GPCR proteolysis site, GPS, motif
6	PF02793 HRM	0.011	27.3	Hormone receptor domain
7	PF02354 Latrophilin	1.4e-104	361.9	Latrophilin Cytoplasmic C-terminal region
8	PF02191 OLF	8.8e-83	289.2	Olfactomedin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000422533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367292	0.998	Leucine-rich repeat transmembrane protein FLRT3
2	9606.ENSP00000429430	0.998	Teneurin-2
3	9606.ENSP00000332879	0.916	Leucine-rich repeat transmembrane protein FLRT2
4	9606.ENSP00000385143	0.823	Netrin receptor UNC5D
5	9606.ENSP00000346839	0.813	Fibronectin type III domain containing
6	9606.ENSP00000403954	0.798	Teneurin-1
7	9606.ENSP00000278550	0.782	Teneurin-4
8	9606.ENSP00000424226	0.768	Teneurin-3
9	9606.ENSP00000325525	0.687	Killer cell immunoglobulin-like receptor 3DL2
10	9606.ENSP00000307134	0.679	Catenin delta-2
11	9606.ENSP00000263736	0.676	S1 RNA-binding domain-containing protein 1
12	9606.ENSP00000381302	0.663	Phospholipid phosphatase 4
13	9606.ENSP00000361110	0.644	Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
14	9606.ENSP00000392553	0.634	Phospholipid phosphatase 5
15	9606.ENSP00000239462	0.633	Tenascin-N
16	9606.ENSP00000265131	0.633	Tenascin
17	9606.ENSP00000356646	0.633	Tenascin-R
18	9606.ENSP00000286574	0.625	Wnt inhibitory factor 1
19	9606.ENSP00000258229	0.623	Pecanex-like protein 2
20	9606.ENSP00000270349	0.582	Sodium-dependent dopamine transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005509	0.931	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050896	0.997	response to stimulus
GO:0051716	0.977	cellular response to stimulus
GO:0050794	0.963	regulation of cellular process
GO:0007155	0.814	cell adhesion
GO:0007186	0.765	G protein-coupled receptor signaling pathway
GO:0032501	0.748	multicellular organismal process
GO:0032502	0.402	developmental process
GO:0098609	0.354	cell-cell adhesion
GO:0048856	0.337	anatomical structure development
GO:0098742	0.318	cell-cell adhesion via plasma-membrane adhesion molecules

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.507	plasma membrane region
GO:0030054	0.409	cell junction
GO:0120025	0.374	plasma membrane bounded cell projection
GO:0005622	0.362	intracellular anatomical structure
GO:0005737	0.343	cytoplasm
GO:0045202	0.332	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]