StarFunc result for job id Q9HAT8

User Input

>input (420 residues)
MFSPGQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVH
VISTPQASKAISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTI
SGSQNTDEAQITQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDG
HMDGLTTNGVLVMHPRGGFTEESQPGVWREISVCGDVYTLRETRSAQQRGKLVESETNVL
QDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAARPQCPVGLNTLAFPSINRKE
VVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAG
PPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAT8	1.000	1.000	2.450E-91	420	1.000	1.000	Q9HAT8.pdb.gz	PELI2_HUMAN E3 ubiquitin-protein ligase pellino homolog 2 OS=Homo sapiens OX=9606 GN=PELI2 PE=1 SV=1
2	AFDB:A4QN36	0.963	0.951	6.544E-76	425	0.800	0.791	A4QN36.pdb.gz	A4QN36_DANRE Pellino E3 ubiquitin protein ligase 1b OS=Danio rerio OX=7955 GN=zgc:153297 PE=2 SV=1
3	AFDB:Q8N2H9	0.957	0.858	6.736E-70	469	0.710	0.635	Q8N2H9.pdb.gz	PELI3_HUMAN E3 ubiquitin-protein ligase pellino homolog 3 OS=Homo sapiens OX=9606 GN=PELI3 PE=1 SV=2
4	AFDB:O77237	0.927	0.918	2.753E-63	424	0.583	0.578	O77237.pdb.gz	PELI_DROME Protein pellino OS=Drosophila melanogaster OX=7227 GN=Pli PE=1 SV=1
5	AFDB:P41813	0.143	0.075	9.388E-3	862	0.062	0.030	P41813.pdb.gz	FKH2_YEAST Fork head protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FKH2 PE=1 SV=1
6	AFDB:P22216	0.196	0.106	2.398E-2	821	0.071	0.037	P22216.pdb.gz	RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD53 PE=1 SV=1
7	AFDB:O60129	0.125	0.087	3.338E-2	642	0.071	0.047	O60129.pdb.gz	FKH2_SCHPO Fork head protein homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fkh2 PE=1 SV=1
8	AFDB:O14270	0.169	0.103	3.728E-2	743	0.076	0.043	O14270.pdb.gz	FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fhl1 PE=3 SV=2
9	AFDB:A7ZRJ5	0.100	0.076	4.398E-2	686	0.086	0.052	A7ZRJ5.pdb.gz	A7ZRJ5_ECO24 General secretion pathway protein D OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=gspD PE=1 SV=1
10	AFDB:Q945P0	0.154	0.290	4.398E-2	209	0.074	0.148	Q945P0.pdb.gz	FHA1_TOBAC Transcriptional activator FHA1 OS=Nicotiana tabacum OX=4097 GN=FHA1 PE=1 SV=1
11	PDB:5wq8A	0.119	0.106	1.318E-1	496	0.088	0.075	5wq8A.pdb.gz
12	PDB:2ff4A	0.155	0.171	3.556E-1	379	0.050	0.055	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
13	PDB:6l9wD	0.141	0.356	3.758E-1	142	0.031	0.092	6l9wD.pdb.gz
14	PDB:2kb3A	0.140	0.351	4.196E-1	143	0.057	0.168	2kb3A.pdb.gz
15	PDB:7et3M	0.090	0.083	4.434E-1	468	0.043	0.038	7et3M.pdb.gz	Structural basis for genome packaging, retention, and ejection in human cytomegalovirus.
16	PDB:1zgsA	0.090	0.087	6.524E-1	442	0.043	0.041	1zgsA.pdb.gz	The first crystal structure of a mimosoideae lectin reveals a novel quaternary arrangement of a widespread domain.
17	PDB:8dysA	0.077	0.078	8.596E-1	409	0.119	0.122	8dysA.pdb.gz
18	PDB:7ns5A	0.084	0.096	9.083E-1	319	0.076	0.100	7ns5A.pdb.gz	GID E3 ligase supramolecular chelate assembly configures multipronged ubiquitin targeting of an oligomeric metabolic enzyme.
19	PDB:5fb4C	0.072	0.063	1.014	516	0.090	0.074	5fb4C.pdb.gz
20	PDB:4jmxA	0.064	0.102	1.072	216	0.048	0.093	4jmxA.pdb.gz	Structures of free and inhibited forms of the L,D-transpeptidase LdtMt1 from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4QN36	0.0	712	425	0.800	0.791	A4QN36_DANRE Pellino E3 ubiquitin protein ligase 1b OS=Danio rerio OX=7955 GN=zgc:153297 PE=2 SV=1
2	Q8BST6	0.0	838	419	0.950	0.952	PELI2_MOUSE E3 ubiquitin-protein ligase pellino homolog 2 OS=Mus musculus OX=10090 GN=Peli2 PE=1 SV=2
3	Q8BXR6	0.0	610	445	0.707	0.667	PELI3_MOUSE E3 ubiquitin-protein ligase pellino homolog 3 OS=Mus musculus OX=10090 GN=Peli3 PE=1 SV=2
4	Q8C669	0.0	738	418	0.812	0.816	PELI1_MOUSE E3 ubiquitin-protein ligase pellino homolog 1 OS=Mus musculus OX=10090 GN=Peli1 PE=1 SV=2
5	Q8N2H9	0.0	598	469	0.710	0.635	PELI3_HUMAN E3 ubiquitin-protein ligase pellino homolog 3 OS=Homo sapiens OX=9606 GN=PELI3 PE=1 SV=2
6	Q96FA3	0.0	740	418	0.814	0.818	PELI1_HUMAN E3 ubiquitin-protein ligase pellino homolog 1 OS=Homo sapiens OX=9606 GN=PELI1 PE=1 SV=2
7	Q9HAT8	0.0	883	420	1.000	1.000	PELI2_HUMAN E3 ubiquitin-protein ligase pellino homolog 2 OS=Homo sapiens OX=9606 GN=PELI2 PE=1 SV=1
8	O77237	8.05e-180	509	424	0.588	0.583	PELI_DROME Protein pellino OS=Drosophila melanogaster OX=7227 GN=Pli PE=1 SV=1
9	K9N643	5.6	31.2	246	0.050	0.085	ORF4B_MERS1 Non-structural protein ORF4b OS=Middle East respiratory syndrome-related coronavirus (isolate United Kingdom/H123990006/2012) OX=1263720 GN=ORF4b PE=1 SV=1
10	P0C631	6.6	30.4	157	0.088	0.236	FUR_CAMJE Ferric uptake regulation protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=fur PE=1 SV=1
11	Q5TG30	8.3	31.2	622	0.055	0.037	RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens OX=9606 GN=ARHGAP40 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04710 Pellino	3.6e-220	742.5	Pellino
2	PF13920 zf-C3HC4_3	85	14.4	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000010689

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003089	0.973	Interleukin-1 receptor-associated kinase 1
2	60711.ENSCSAP00000003071	0.849	Interleukin-1 receptor-associated kinase 4
3	60711.ENSCSAP00000001791	0.846	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
4	60711.ENSCSAP00000013306	0.737	Mitogen-activated protein kinase kinase kinase 7
5	60711.ENSCSAP00000013252	0.678	TGF-beta activated kinase 1/MAP3K7 binding protein 2
6	60711.ENSCSAP00000003492	0.631	Receptor (TNFRSF)-interacting serine-threonine kinase 1
7	60711.ENSCSAP00000002648	0.628	TGF-beta activated kinase 1/MAP3K7 binding protein 1
8	60711.ENSCSAP00000001972	0.595	Conserved helix-loop-helix ubiquitous kinase
9	60711.ENSCSAP00000006279	0.595	Interleukin-1 receptor-associated kinase 2
10	60711.ENSCSAP00000011175	0.593	TMEM189-UBE2V1 readthrough
11	60711.ENSCSAP00000011145	0.589	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
12	60711.ENSCSAP00000016593	0.587	B-cell CLL/lymphoma 10
13	60711.ENSCSAP00000000080	0.576	Belongs to the ubiquitin-conjugating enzyme family.
14	60711.ENSCSAP00000017712	0.576	Ubiquitin-conjugating enzyme E2N
15	60711.ENSCSAP00000000725	0.565	Interleukin-1 receptor-associated kinase 3
16	60711.ENSCSAP00000005015	0.565	LIM domain kinase 2
17	60711.ENSCSAP00000008660	0.565	Protein kinase domain containing, cytoplasmic
18	60711.ENSCSAP00000014207	0.565	LIM domain kinase 1
19	60711.ENSCSAP00000011939	0.559	Receptor-interacting serine-threonine kinase 3
20	60711.ENSCSAP00000009415	0.544	Mothers against decapentaplegic homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0034450	0.344	ubiquitin-ubiquitin ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0043123	0.987	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0000209	0.985	protein polyubiquitination
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0050896	0.981	response to stimulus
GO:0009987	0.975	cellular process
GO:0048519	0.971	negative regulation of biological process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0048523	0.964	negative regulation of cellular process
GO:0031399	0.951	regulation of protein modification process
GO:0009607	0.935	response to biotic stimulus
GO:0009605	0.935	response to external stimulus
GO:0051707	0.930	response to other organism
GO:0044237	0.919	cellular metabolic process
GO:0009893	0.894	positive regulation of metabolic process
GO:0070936	0.890	protein K48-linked ubiquitination
GO:0010941	0.881	regulation of cell death
GO:0010604	0.880	positive regulation of macromolecule metabolic process
GO:0009889	0.866	regulation of biosynthetic process
GO:0031326	0.864	regulation of cellular biosynthetic process
GO:0080134	0.835	regulation of response to stress
GO:0002682	0.812	regulation of immune system process
GO:0019220	0.811	regulation of phosphate metabolic process
GO:0051090	0.807	regulation of DNA-binding transcription factor activity
GO:0031401	0.795	positive regulation of protein modification process
GO:0042221	0.780	response to chemical
GO:0010033	0.760	response to organic substance
GO:0042325	0.745	regulation of phosphorylation
GO:0043069	0.744	negative regulation of programmed cell death
GO:0010562	0.739	positive regulation of phosphorus metabolic process
GO:0002831	0.701	regulation of response to biotic stimulus
GO:0050776	0.687	regulation of immune response
GO:0010939	0.686	regulation of necrotic cell death
GO:0002684	0.686	positive regulation of immune system process
GO:0002376	0.684	immune system process
GO:0050778	0.652	positive regulation of immune response
GO:0051716	0.642	cellular response to stimulus
GO:0002833	0.631	positive regulation of response to biotic stimulus
GO:0045088	0.628	regulation of innate immune response
GO:0006950	0.563	response to stress
GO:0031349	0.544	positive regulation of defense response
GO:0032103	0.474	positive regulation of response to external stimulus
GO:0051239	0.465	regulation of multicellular organismal process
GO:0045937	0.462	positive regulation of phosphate metabolic process
GO:0007165	0.401	signal transduction
GO:1901700	0.391	response to oxygen-containing compound
GO:0045089	0.355	positive regulation of innate immune response
GO:0042327	0.347	positive regulation of phosphorylation
GO:0001932	0.341	regulation of protein phosphorylation
GO:0009617	0.334	response to bacterium
GO:0006952	0.332	defense response
GO:0001817	0.316	regulation of cytokine production
GO:0044093	0.313	positive regulation of molecular function
GO:0033993	0.302	response to lipid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	0.971	intracellular membrane-bounded organelle
GO:0005634	0.937	nucleus
GO:0016020	0.669	membrane
GO:0070013	0.646	intracellular organelle lumen
GO:0031981	0.456	nuclear lumen
GO:0005654	0.394	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]