StarFunc result for job id Q9HAU0

User Input

>input (1116 residues)
MAADLNLEWISLPRSWTYGITRGGRVFFINEEAKSTTWLHPVTGEAVVTGHRRQSTDLPT
GWEEAYTFEGARYYINHNERKVTCKHPVTGQPSQDNCIFVVNEQTVATMTSEEKKERPIS
MINEASNYNVTSDYAVHPMSPVGRTSRASKKVHNFGKRSNSIKRNPNAPVVRRGWLYKQD
STGMKLWKKRWFVLSDLCLFYYRDEKEEGILGSILLPSFQIALLTSEDHINRKYAFKAAH
PNMRTYYFCTDTGKEMELWMKAMLDAALVQTEPVKRVDKITSENAPTKETNNIPNHRVLI
KPEIQNNQKNKEMSKIEEKKALEAEKYGFQKDGQDRPLTKINSVKLNSLPSEYESGSACP
AQTVHYRPINLSSSENKIVNVSLADLRGGNRPNTGPLYTEADRVIQRTNSMQQLEQWIKI
QKGRGHEEETRGVISYQTLPRNMPSHRAQIMARYPEGYRTLPRNSKTRPESICSVTPSTH
DKTLGPGAEEKRRSMRDDTMWQLYEWQQRQFYNKQSTLPRHSTLSSPKTMVNISDQTMHS
IPTSPSHGSIAAYQGYSPQRTYRSEVSSPIQRGDVTIDRRHRAHHPKHVYVPDRRSVPAG
LTLQSVSPQSLQGKTLSQDEGRGTLYKYRPEEVDIDAKLSRLCEQDKVVHALEEKLQQLH
KEKYTLEQALLSASQEIEMHADNPAAIQTVVLQRDDLQNGLLSTCRELSRATAELERAWR
EYDKLEYDVTVTRNQMQEQLDHLGEVQTESAGIQRAQIQKELWRIQDVMEGLSKHKQQRG
TTEIGMIGSKPFSTVKYKNEGPDYRLYKSEPELTTVAEVDESNGEEKSEPVSEIETSVVK
GSHFPVGVVPPRAKSPTPESSTIASYVTLRKTKKMMDLRTERPRSAVEQLCLAESTRPRM
TVEEQMERIRRHQQACLREKKKGLNVIGASDQSPLQSPSNLRDNPFRTTQTRRRDDKELD
TAIRENDVKPDHETPATEIVQLKETEPQNVDFSKELKKTENISYEMLFEPEPNGVNSVEM
MDKERNKDKMPEDVTFSPQDETQTANHKPEEHPEENTKNSVDEQEETVISYESTPEVSRG
NQTMAVKSLSPSPESSASPVPSTQPQLTEGSHFMCV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAY7	0.189	0.181	0.000	1174	0.996	0.947	A0A024RAY7.pdb.gz
2	AFDB:E9Q6H8	0.193	0.173	0.000	1269	0.844	0.742	E9Q6H8.pdb.gz	E9Q6H8_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
3	AFDB:Q9HAU0	0.999	0.999	0.000	1116	1.000	1.000	Q9HAU0.pdb.gz	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
4	AFDB:B6RSP1	0.163	0.153	9.116E-44	1197	0.291	0.272	B6RSP1.pdb.gz	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
5	AFDB:E9PKC0	0.156	0.142	6.981E-41	1271	0.312	0.274	E9PKC0.pdb.gz	E9PKC0_HUMAN Pleckstrin homology domain containing A7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
6	PDB:6bbpA	0.079	0.167	7.898E-7	520	0.025	0.054	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
7	PDB:3ljuX	0.089	0.256	1.305E-6	373	0.017	0.051	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
8	AFDB:Q9QYY0	0.086	0.135	1.627E-6	695	0.111	0.178	Q9QYY0.pdb.gz	GAB1_MOUSE GRB2-associated-binding protein 1 OS=Mus musculus OX=10090 GN=Gab1 PE=1 SV=2
9	AFDB:F1Q7S5	0.093	0.132	1.721E-6	740	0.099	0.149	F1Q7S5.pdb.gz	F1Q7S5_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=1
10	PDB:6u3eA	0.078	0.215	5.889E-6	397	0.026	0.073	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
11	AFDB:Q9UQC2	0.098	0.156	6.211E-6	676	0.096	0.158	Q9UQC2.pdb.gz	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1
12	PDB:6hhgA	0.082	0.229	1.608E-5	386	0.021	0.060	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
13	PDB:7rx9A	0.080	0.199	1.798E-5	432	0.015	0.039	7rx9A.pdb.gz
14	PDB:4mt6A	0.082	0.224	1.901E-5	389	0.015	0.044	4mt6A.pdb.gz
15	AFDB:P49796	0.100	0.094	3.133E-5	1198	0.056	0.052	P49796.pdb.gz	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
16	PDB:6s9wA	0.079	0.209	4.643E-5	411	0.020	0.054	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
17	PDB:4mk0A	0.087	0.149	8.578E-5	631	0.021	0.036	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:4iapA	0.066	0.270	2.477E-4	256	0.013	0.059	4iapA.pdb.gz
19	AFDB:Q5VUA4	0.098	0.053	4.826E-4	2279	0.136	0.067	Q5VUA4.pdb.gz	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
20	PDB:3uzsA	0.081	0.142	6.763E-4	609	0.017	0.031	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0N4SUU0	0.0	1364	956	0.586	0.684	A0A0N4SUU0_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
2	A0A0N4SUV0	0.0	965	525	0.408	0.867	A0A0N4SUV0_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
3	A0A0N4SUY3	0.0	1137	668	0.501	0.837	A0A0N4SUY3_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
4	A0A0N4SV65	0.0	1065	662	0.480	0.810	A0A0N4SV65_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
5	A0A0N4SW19	0.0	958	531	0.408	0.857	A0A0N4SW19_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
6	A0A0N4SWD7	0.0	1747	1000	0.763	0.851	A0A0N4SWD7_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
7	A0A0N4SWF5	0.0	790	770	0.340	0.492	A0A0N4SWF5_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
8	A0JP02	0.0	1808	874	0.783	1.000	A0JP02_HUMAN PLEKHA5 protein OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
9	B4DJX4	0.0	1449	977	0.620	0.708	B4DJX4_HUMAN Pleckstrin homology domain containing A5 (Fragment) OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
10	E9Q6H8	0.0	1195	1269	0.503	0.442	E9Q6H8_MOUSE Pleckstrin homology domain containing, family A member 5 OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
11	Q6ZPK1	0.0	1061	1205	0.446	0.413	Q6ZPK1_MOUSE MKIAA1686 protein (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
12	Q8CIA7	0.0	1409	853	0.630	0.824	Q8CIA7_MOUSE Plekha5 protein OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
13	Q8VDM7	0.0	1040	645	0.466	0.806	Q8VDM7_MOUSE Plekha5 protein OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
14	Q91YS3	0.0	675	708	0.289	0.456	Q91YS3_MOUSE Plekha5 protein OS=Mus musculus OX=10090 GN=Plekha5 PE=2 SV=1
15	Q9HAU0	0.0	2330	1116	1.000	1.000	PKHA5_HUMAN Pleckstrin homology domain-containing family A member 5 OS=Homo sapiens OX=9606 GN=PLEKHA5 PE=1 SV=1
16	A0A0N4SVR9	4.35e-139	424	324	0.205	0.707	A0A0N4SVR9_MOUSE Pleckstrin homology domain containing, family A member 5 (Fragment) OS=Mus musculus OX=10090 GN=Plekha5 PE=1 SV=1
17	Q6IQ23	2.64e-132	432	1121	0.272	0.270	PKHA7_HUMAN Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=2
18	E9PKC0	3.92e-131	432	1271	0.272	0.238	E9PKC0_HUMAN Pleckstrin homology domain containing A7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=1
19	Q3UIL6	3.43e-130	426	1118	0.275	0.275	PKHA7_MOUSE Pleckstrin homology domain-containing family A member 7 OS=Mus musculus OX=10090 GN=Plekha7 PE=1 SV=2
20	A0A8I5ZXL6	1.88e-128	422	1116	0.269	0.269	A0A8I5ZXL6_RAT Pleckstrin homology domain containing A7 OS=Rattus norvegicus OX=10116 GN=Plekha7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20531 DUF6746	1.1e+02	14.1	Family of unknown function (DUF6746)
2	PF00169 PH	6e-15	67.0	PH domain
3	PF15413 PH_11	0.22	23.4	Pleckstrin homology domain
4	PF20399 PH_20	17	16.9	PH domain
5	PF14593 PH_3	22	16.5	PH domain
6	PF15409 PH_8	4.7e+02	12.5	Pleckstrin homology domain
7	PF00397 WW	5e-11	53.8	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000018391

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000019156	0.706	UBX domain protein 7
2	9612.ENSCAFP00000012240	0.594	Ssemaphorin 4F
3	9612.ENSCAFP00000037431	0.576	Ubiquitin-conjugating enzyme E2K
4	9612.ENSCAFP00000039391	0.576	Uncharacterized protein
5	9612.ENSCAFP00000037410	0.570	Uncharacterized protein
6	9612.ENSCAFP00000015907	0.526	Leucine rich repeat containing 28
7	9612.ENSCAFP00000021649	0.522	Uncharacterized protein
8	9612.ENSCAFP00000015639	0.519	Thyroid hormone receptor interactor 12
9	9612.ENSCAFP00000009854	0.514	PC-esterase domain containing 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070273	1.000	phosphatidylinositol-4-phosphate binding
GO:0032266	1.000	phosphatidylinositol-3-phosphate binding
GO:0010314	1.000	phosphatidylinositol-5-phosphate binding
GO:0080025	1.000	phosphatidylinositol-3,5-bisphosphate binding
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.985	multicellular organism development
GO:0048731	0.984	system development
GO:0061458	0.974	reproductive system development
GO:0009987	0.397	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005829	1.000	cytosol
GO:0031981	0.986	nuclear lumen
GO:0005654	0.984	nucleoplasm
GO:0030054	0.898	cell junction
GO:0016020	0.872	membrane
GO:0098794	0.560	postsynapse
GO:0099572	0.547	postsynaptic specialization
GO:0014069	0.535	postsynaptic density
GO:0071944	0.365	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]