StarFunc result for job id Q9HAU4

User Input

>input (748 residues)
MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDT
ECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHL
SYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILEND
ITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLA
LQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAV
EFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRI
DIPPYESYEKLYEKLLTAIEETCGFAVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K612	0.517	0.528	0.000	731	0.759	0.777	A0A0G2K612.pdb.gz	A0A0G2K612_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=2
2	AFDB:A2A5Z6	0.553	0.553	0.000	748	0.991	0.991	A2A5Z6.pdb.gz	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1
3	AFDB:Q9CUN6	0.519	0.530	0.000	731	0.759	0.777	Q9CUN6.pdb.gz	SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus OX=10090 GN=Smurf1 PE=1 SV=2
4	AFDB:Q9V853	0.511	0.364	3.604E-91	1061	0.620	0.437	Q9V853.pdb.gz	SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster OX=7227 GN=Smurf PE=1 SV=3
5	AFDB:Q92462	0.362	0.354	3.012E-73	767	0.449	0.438	Q92462.pdb.gz	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
6	AFDB:O14326	0.509	0.485	1.026E-72	786	0.402	0.383	O14326.pdb.gz	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
7	AFDB:Q5BDP1	0.381	0.349	1.524E-69	821	0.437	0.398	Q5BDP1.pdb.gz	RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hulA PE=1 SV=1
8	AFDB:P39940	0.358	0.332	7.424E-69	809	0.420	0.388	P39940.pdb.gz	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
9	AFDB:U6C7R6	0.360	0.313	1.161E-65	867	0.398	0.344	U6C7R6.pdb.gz	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1
10	AFDB:Q9VVI3	0.494	0.369	1.659E-65	1007	0.398	0.296	Q9VVI3.pdb.gz	NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster OX=7227 GN=Nedd4 PE=1 SV=2
11	PDB:7jq9A	0.333	0.107	8.216E-35	2427	0.229	0.070	7jq9A.pdb.gz
12	PDB:7mopA	0.324	0.104	2.516E-33	2445	0.225	0.069	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:1cjyA	0.141	0.165	3.751E-7	633	0.028	0.033	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:6kxkD	0.146	0.192	3.751E-7	553	0.035	0.047	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
15	PDB:5iz5B	0.148	0.148	3.947E-7	746	0.032	0.032	5iz5B.pdb.gz
16	PDB:5ixcA	0.141	0.153	4.842E-7	684	0.029	0.032	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5izrC	0.138	0.156	6.251E-7	659	0.029	0.033	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
18	PDB:5a50A	0.135	0.552	1.096E-6	165	0.041	0.188	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:4rj9A	0.132	0.556	2.023E-6	161	0.043	0.199	4rj9A.pdb.gz
20	PDB:5iz5A	0.142	0.140	2.749E-6	757	0.031	0.030	5iz5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K105	0.0	1103	709	0.741	0.781	A0A0G2K105_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=1
2	A0A0G2K612	0.0	1139	757	0.766	0.757	A0A0G2K612_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=2
3	A0A8I5Y0P5	0.0	1522	756	0.971	0.960	A0A8I5Y0P5_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf2 PE=1 SV=1
4	A0A8I5ZK23	0.0	1102	706	0.731	0.775	A0A8I5ZK23_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=1
5	A0A8I5ZUV2	0.0	1343	695	0.894	0.963	A0A8I5ZUV2_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Smurf2 PE=1 SV=1
6	A0A8I6A1F1	0.0	1514	735	0.973	0.990	A0A8I6A1F1_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf2 PE=1 SV=1
7	A2A5Z6	0.0	1552	748	0.992	0.992	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1
8	D3ZCF5	0.0	1115	718	0.749	0.780	D3ZCF5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=3
9	F1M3F2	0.0	1554	748	0.992	0.992	F1M3F2_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf2 PE=4 SV=3
10	J3QQM4	0.0	1160	561	0.749	0.998	J3QQM4_HUMAN HECT-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=SMURF2 PE=1 SV=1
11	Q92462	0.0	579	767	0.441	0.430	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
12	Q9CUN6	0.0	1152	731	0.766	0.784	SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus OX=10090 GN=Smurf1 PE=1 SV=2
13	Q9HAU4	0.0	1562	748	1.000	1.000	SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens OX=9606 GN=SMURF2 PE=1 SV=1
14	Q9HCE7	0.0	1149	757	0.766	0.757	SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 OS=Homo sapiens OX=9606 GN=SMURF1 PE=1 SV=2
15	Q9PUN2	0.0	1122	731	0.743	0.761	SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis OX=8355 GN=smurf1 PE=2 SV=1
16	Q9V853	0.0	707	1061	0.460	0.324	SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster OX=7227 GN=Smurf PE=1 SV=3
17	P39940	8.94e-171	513	809	0.357	0.330	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
18	D7NIW0	9.02e-169	513	968	0.376	0.290	D7NIW0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
19	A0A8I6GLU0	9.08e-169	512	956	0.369	0.289	A0A8I6GLU0_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1
20	A0A8I6A4L5	9.73e-169	513	976	0.376	0.288	A0A8I6A4L5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Nedd4l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	4.6e-13	60.7	C2 domain
2	PF20454 GpA_nuclease	2.8e+02	12.2	Terminase large subunit gpA, endonuclease domain
3	PF00632 HECT	1.8e-88	308.6	HECT-domain (ubiquitin-transferase)
4	PF00397 WW	3.4e-26	102.3	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000009604

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000010278	0.999	Mothers against decapentaplegic homolog
2	9601.ENSPPYP00000021783	0.997	Receptor protein serine/threonine kinase
3	9601.ENSPPYP00000010275	0.985	Receptor-regulated SMAD (R-SMAD) that is an intracellular signal transducer and transcriptional modulator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE element in the promoter region of many genes that are regulated by TGF-beta and, on formation of the SMAD2/SMAD4 complex, activates transcription. May act as a tumor suppressor in colorectal carcinoma. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator (By similarity)
4	9601.ENSPPYP00000007463	0.981	Mothers against decapentaplegic homolog
5	9601.ENSPPYP00000007465	0.978	Mothers against decapentaplegic homolog
6	9601.ENSPPYP00000007372	0.954	E3 ubiquitin-protein ligase
7	9601.ENSPPYP00000015718	0.954	TGF-beta receptor type-2
8	9601.ENSPPYP00000001647	0.929	Patched 2
9	9601.ENSPPYP00000016868	0.917	Uncharacterized protein
10	9601.ENSPPYP00000016869	0.917	Uncharacterized protein
11	9601.ENSPPYP00000019458	0.915	SMAD specific E3 ubiquitin protein ligase 1
12	9601.ENSPPYP00000003845	0.897	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
13	9601.ENSPPYP00000005811	0.887	Ubiquitin C
14	9601.ENSPPYP00000010317	0.883	E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Inhibits TGF- beta signaling by triggering SMAD2 and TGFBR1 ubiquitination and proteasome-dependent degradation. Promotes ubiquitination and internalization of various plasma membrane channels such as ENaC, Nav1.2, Nav1.3, Nav1.5, Nav1.7, Nav1.8, Kv1.3, KCNH2, EAAT1 or CLC5. Promotes ubiquitination and degradation of SGK1 and TNK2. Ubiquitinates BRAT1 and this ubiquitination is enhanced in the presence o [...]
15	9601.ENSPPYP00000015183	0.870	Cbl proto-oncogene B, E3 ubiquitin protein ligase
16	9601.ENSPPYP00000017676	0.870	Mothers against decapentaplegic homolog 5
17	9601.ENSPPYP00000004540	0.868	Cbl proto-oncogene, E3 ubiquitin protein ligase
18	9601.ENSPPYP00000001585	0.861	Ring finger protein 11
19	9601.ENSPPYP00000015522	0.854	Transforming protein RhoA
20	9601.ENSPPYP00000002821	0.851	Ubiquitin-conjugating enzyme E2D 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0046332	0.999	SMAD binding
GO:0005160	0.999	transforming growth factor beta receptor binding
GO:0061630	0.986	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048519	0.989	negative regulation of biological process
GO:0050793	0.967	regulation of developmental process
GO:0048518	0.958	positive regulation of biological process
GO:0048583	0.948	regulation of response to stimulus
GO:0048522	0.945	positive regulation of cellular process
GO:0023051	0.935	regulation of signaling
GO:0010646	0.934	regulation of cell communication
GO:0071704	0.920	organic substance metabolic process
GO:0044238	0.920	primary metabolic process
GO:0006807	0.902	nitrogen compound metabolic process
GO:0009966	0.892	regulation of signal transduction
GO:0043170	0.890	macromolecule metabolic process
GO:0019222	0.876	regulation of metabolic process
GO:0050896	0.865	response to stimulus
GO:1901564	0.813	organonitrogen compound metabolic process
GO:0060255	0.808	regulation of macromolecule metabolic process
GO:0019538	0.795	protein metabolic process
GO:0080090	0.793	regulation of primary metabolic process
GO:0051171	0.792	regulation of nitrogen compound metabolic process
GO:0048523	0.776	negative regulation of cellular process
GO:0051239	0.764	regulation of multicellular organismal process
GO:0051716	0.698	cellular response to stimulus
GO:0036211	0.665	protein modification process
GO:0009893	0.579	positive regulation of metabolic process
GO:0031323	0.573	regulation of cellular metabolic process
GO:0010604	0.565	positive regulation of macromolecule metabolic process
GO:0051173	0.555	positive regulation of nitrogen compound metabolic process
GO:0007154	0.544	cell communication
GO:0023052	0.543	signaling
GO:0044237	0.517	cellular metabolic process
GO:0007165	0.504	signal transduction
GO:0070647	0.468	protein modification by small protein conjugation or removal
GO:0032502	0.465	developmental process
GO:0071840	0.453	cellular component organization or biogenesis
GO:0048584	0.449	positive regulation of response to stimulus
GO:0032446	0.441	protein modification by small protein conjugation
GO:0010468	0.425	regulation of gene expression
GO:0016043	0.410	cellular component organization
GO:0007166	0.375	cell surface receptor signaling pathway
GO:0051246	0.368	regulation of protein metabolic process
GO:0048856	0.356	anatomical structure development
GO:0023056	0.347	positive regulation of signaling
GO:0009892	0.345	negative regulation of metabolic process
GO:0009967	0.340	positive regulation of signal transduction
GO:0048585	0.336	negative regulation of response to stimulus
GO:0019219	0.335	regulation of nucleobase-containing compound metabolic process
GO:0006508	0.332	proteolysis
GO:0016567	0.330	protein ubiquitination
GO:0010605	0.329	negative regulation of macromolecule metabolic process
GO:0009889	0.325	regulation of biosynthetic process
GO:0031326	0.319	regulation of cellular biosynthetic process
GO:0051252	0.318	regulation of RNA metabolic process
GO:0051247	0.316	positive regulation of protein metabolic process
GO:0010556	0.315	regulation of macromolecule biosynthetic process
GO:0006355	0.309	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:0016020	0.848	membrane
GO:1902494	0.721	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]