StarFunc result for job id Q9HAU5

User Input

>input (1272 residues)
MPAERKKPASMEEKDSLPNNKEKDCSERRTVSSKERPKDDIKLTAKKEVSKAPEDKKKRL
EDDKRKKEDKERKKKDEEKVKAEEESKKKEEEEKKKHQEEERKKQEEQAKRQQEEEAAAQ
MKEKEESIQLHQEAWERHHLRKELRSKNQNAPDSRPEENFFSRLDSSLKKNTAFVKKLKT
ITEQQRDSLSHDFNGLNLSKYIAEAVASIVEAKLKISDVNCAVHLCSLFHQRYADFAPSL
LQVWKKHFEARKEEKTPNITKLRTDLRFIAELTIVGIFTDKEGLSLIYEQLKNIINADRE
SHTHVSVVISFCRHCGDDIAGLVPRKVKSAAEKFNLSFPPSEIISPEKQQPFQNLLKEYF
TSLTKHLKRDHRELQNTERQNRRILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLL
DENMPDLPQDKPTPEEHGPGIDIFTPGKPGEYDLEGGIWEDEDARNFYENLIDLKAFVPA
ILFKDNEKSCQNKESNKDDTKEAKESKENKEVSSPDDLELELENLEINDDTLELEGGDEA
EDLTKKLLDEQEQEDEEASTGSHLKLIVDAFLQQLPNCVNRDLIDKAAMDFCMNMNTKAN
RKKLVRALFIVPRQRLDLLPFYARLVATLHPCMSDVAEDLCSMLRGDFRFHVRKKDQINI
ETKNKTVRFIGELTKFKMFTKNDTLHCLKMLLSDFSHHHIEMACTLLETCGRFLFRSPES
HLRTSVLLEQMMRKKQAMHLDARYVTMVENAYYYCNPPPAEKTVKKKRPPLQEYVRKLLY
KDLSKVTTEKVLRQMRKLPWQDQEVKDYVICCMINIWNVKYNSIHCVANLLAGLVLYQED
VGIHVVDGVLEDIRLGMEVNQPKFNQRRISSAKFLGELYNYRMVESAVIFRTLYSFTSFG
VNPDGSPSSLDPPEHLFRIRLVCTILDTCGQYFDRGSSKRKLDCFLVYFQRYVWWKKSLE
VWTKDHPFPIDIDYMISDTLELLRPKIKLCNSLEESIRQVQDLEREFLIKLGLVNDKDSK
DSMTEGENLEEDEEEEEGGAETEEQSGNESEVNEPEEEEGSDNDDDEGEEEEEENTDYLT
DSNKENETDEENTEVMIKGGGLKHVPCVEDEDFIQALDKMMLENLQQRSGESVKVHQLDV
AIPLHLKSQLRKGPPLGGGEGEAESADTMPFVMLTRKGNKQQFKILNVPMSSQLAANHWN
QQQAEQEERMRMKKLTLDINERQEQEDYQEMLQSLAQRPAPANTNRERRPRYQHPKGAPN
ADLIFKTGGRRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAU5	1.000	1.000	0.000	1272	1.000	1.000	Q9HAU5.pdb.gz	RENT2_HUMAN Regulator of nonsense transcripts 2 OS=Homo sapiens OX=9606 GN=UPF2 PE=1 SV=1
2	AFDB:Q9W3L1	0.461	0.472	1.967E-65	1241	0.347	0.356	Q9W3L1.pdb.gz	Q9W3L1_DROME RE04053p OS=Drosophila melanogaster OX=7227 GN=Upf2 PE=1 SV=1
3	AFDB:C2BR97	0.298	0.327	5.612E-48	1144	0.230	0.256	C2BR97.pdb.gz	C2BR97_CAEEL MIF4G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-3 PE=1 SV=1
4	PDB:4c0qA	0.109	0.148	2.253E-5	871	0.089	0.130	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
5	PDB:7dvqV	0.155	0.380	3.080E-5	468	0.047	0.128	7dvqV.pdb.gz	Structure of the activated human minor spliceosome.
6	PDB:6gx9A	0.105	0.137	5.533E-5	912	0.085	0.118	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
7	AFDB:Q62018	0.079	0.082	9.379E-5	1173	0.106	0.115	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
8	PDB:6bcuA	0.108	0.075	1.034E-4	2204	0.098	0.057	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
9	PDB:1wa5C	0.108	0.137	1.162E-4	950	0.090	0.120	1wa5C.pdb.gz	Structural basis for the assembly of a nuclear export complex.
10	PDB:4a0cA	0.104	0.111	1.162E-4	1155	0.106	0.117	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
11	PDB:2xwuB	0.098	0.127	1.307E-4	910	0.079	0.110	2xwuB.pdb.gz
12	PDB:5gm6Z	0.141	0.371	1.718E-4	447	0.046	0.130	5gm6Z.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	AFDB:Q7Z460	0.118	0.103	1.822E-4	1538	0.090	0.074	Q7Z460.pdb.gz	CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1
14	PDB:5mqfT	0.151	0.440	1.857E-4	395	0.044	0.142	5mqfT.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
15	PDB:5gm6G	0.109	0.149	2.745E-4	875	0.074	0.107	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	AFDB:Q21227	0.088	0.093	4.138E-4	1188	0.069	0.074	Q21227.pdb.gz	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2
17	AFDB:A0A0G2K8V3	0.131	0.110	4.837E-4	1613	0.103	0.081	A0A0G2K8V3.pdb.gz	A0A0G2K8V3_RAT THO complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Thoc2 PE=1 SV=2
18	AFDB:Q38AX3	0.120	0.100	1.235E-3	1594	0.126	0.100	Q38AX3.pdb.gz	Q38AX3_TRYB2 Kinetoplastid kinetochore protein 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0500 PE=1 SV=1
19	AFDB:Q8NI27	0.119	0.099	1.336E-3	1593	0.114	0.091	Q8NI27.pdb.gz	THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2
20	AFDB:P10870	0.049	0.065	3.033E-3	884	0.085	0.122	P10870.pdb.gz	SNF3_YEAST Low glucose sensor SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF3 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AT37	0.0	2540	1269	0.969	0.972	RENT2_MOUSE Regulator of nonsense transcripts 2 OS=Mus musculus OX=10090 GN=Upf2 PE=1 SV=1
2	F4IUX6	0.0	634	1181	0.336	0.362	RENT2_ARATH Regulator of nonsense transcripts UPF2 OS=Arabidopsis thaliana OX=3702 GN=UPF2 PE=2 SV=1
3	Q9HAU5	0.0	2628	1272	1.000	1.000	RENT2_HUMAN Regulator of nonsense transcripts 2 OS=Homo sapiens OX=9606 GN=UPF2 PE=1 SV=1
4	Q9W3L1	0.0	746	1241	0.347	0.356	Q9W3L1_DROME RE04053p OS=Drosophila melanogaster OX=7227 GN=Upf2 PE=1 SV=1
5	Q5AYD5	2.10e-168	534	1170	0.292	0.318	Q5AYD5_EMENI Nonsense-mediated mRNA decay factor (Upf2), putative (AFU_orthologue AFUA_7G05430) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06695 PE=4 SV=1
6	Q7YU82	8.04e-138	438	698	0.194	0.354	Q7YU82_DROME SD07232p OS=Drosophila melanogaster OX=7227 GN=Upf2 PE=2 SV=1
7	C2BR97	7.80e-109	372	1144	0.194	0.216	C2BR97_CAEEL MIF4G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-3 PE=1 SV=1
8	G5EDT8	9.02e-109	372	1142	0.194	0.216	G5EDT8_CAEEL MIF4G domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-3 PE=1 SV=1
9	O13824	4.68e-69	255	1049	0.148	0.179	NMD2_SCHPO Nonsense-mediated mRNA decay protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf2 PE=1 SV=1
10	P38798	3.42e-39	161	1089	0.087	0.102	NMD2_YEAST Nonsense-mediated mRNA decay protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMD2 PE=1 SV=2
11	Q385C8	7.47e-09	62.8	1454	0.055	0.048	Q385C8_TRYB2 MIF4G domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4270 PE=4 SV=1
12	O35889	0.002	45.1	1829	0.022	0.015	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
13	Q9QZQ1	0.002	44.7	1820	0.021	0.015	AFAD_MOUSE Afadin OS=Mus musculus OX=10090 GN=Afdn PE=1 SV=3
14	Q57TX7	0.033	41.2	2197	0.033	0.019	Q57TX7_TRYB2 Kinetoplast DNA-associated protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.380 PE=4 SV=1
15	Q10475	0.081	39.7	1403	0.020	0.019	IF4G_SCHPO Eukaryotic translation initiation factor 4 gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tif471 PE=1 SV=1
16	A1Z8M2	0.10	39.7	2999	0.028	0.012	A1Z8M2_DROME Toutatis, isoform A OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=2
17	A8DYA3	0.12	39.3	3131	0.028	0.011	A8DYA3_DROME Toutatis, isoform E OS=Drosophila melanogaster OX=7227 GN=tou PE=1 SV=1
18	P0C053	0.67	36.6	444	0.020	0.059	ESSB_STAAE Type VII secretion system protein EssB OS=Staphylococcus aureus (strain Newman) OX=426430 GN=essB PE=1 SV=1
19	F4J0L7	0.84	36.6	2156	0.020	0.012	F4J0L7_ARATH Uncharacterized protein OS=Arabidopsis thaliana OX=3702 GN=At3g50370 PE=1 SV=1
20	Q5A782	1.4	35.8	1017	0.017	0.022	Q5A782_CANAL Eukaryotic translation initiation factor 5B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FUN12 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02854 MIF4G	2.3e-77	271.0	MIF4G domain
2	PF04050 Upf2	6.3e-29	112.8	Up-frameshift suppressor 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000276201	0.999	Regulator of nonsense transcripts 3B
2	9606.ENSP00000364448	0.999	Regulator of nonsense transcripts 3A
3	9606.ENSP00000402515	0.999	Serine/threonine-protein kinase SMG1
4	9606.ENSP00000463058	0.999	RNA-binding protein 8A
5	9606.ENSP00000470142	0.999	Regulator of nonsense transcripts 1
6	9606.ENSP00000264645	0.995	Protein CASC3
7	9606.ENSP00000269349	0.991	Eukaryotic initiation factor 4A-III
8	9606.ENSP00000360525	0.990	Protein mago nashi homolog
9	9606.ENSP00000457723	0.988	RNA-binding protein with serine-rich domain 1
10	9606.ENSP00000319240	0.961	Protein mago nashi homolog 2
11	9606.ENSP00000263073	0.955	Telomerase-binding protein EST1A
12	9606.ENSP00000355261	0.953	Protein SMG5
13	9606.ENSP00000425133	0.953	Protein SMG7
14	9606.ENSP00000386156	0.947	Partner of Y14 and mago
15	9606.ENSP00000270066	0.928	Protein SMG9
16	9606.ENSP00000264951	0.897	5'-3' exoribonuclease 1
17	9606.ENSP00000356811	0.892	HBS1-like protein
18	9606.ENSP00000373715	0.892	m7GpppN-mRNA hydrolase
19	9606.ENSP00000364289	0.881	Nuclear cap-binding protein subunit 1
20	9606.ENSP00000438748	0.881	Protein SMG8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0060090	1.000	molecular adaptor activity
GO:0005515	1.000	protein binding
GO:0042162	1.000	telomeric DNA binding
GO:0003723	0.700	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.984	primary metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0043170	0.976	macromolecule metabolic process
GO:0010468	0.966	regulation of gene expression
GO:0016070	0.966	RNA metabolic process
GO:0044260	0.957	cellular macromolecule metabolic process
GO:0006402	0.949	mRNA catabolic process
GO:0000956	0.935	nuclear-transcribed mRNA catabolic process
GO:0010467	0.923	gene expression
GO:0015931	0.841	nucleobase-containing compound transport
GO:0006403	0.807	RNA localization
GO:0051169	0.804	nuclear transport
GO:0050658	0.800	RNA transport
GO:0000184	0.774	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0051028	0.773	mRNA transport
GO:0032501	0.772	multicellular organismal process
GO:0051168	0.770	nuclear export
GO:0032502	0.766	developmental process
GO:0048856	0.738	anatomical structure development
GO:0007275	0.709	multicellular organism development
GO:0006405	0.708	RNA export from nucleus
GO:0006406	0.627	mRNA export from nucleus
GO:0061008	0.592	hepaticobiliary system development
GO:0031099	0.574	regeneration
GO:0048513	0.566	animal organ development
GO:0031100	0.524	animal organ regeneration
GO:0050794	0.490	regulation of cellular process
GO:0048732	0.360	gland development
GO:0051171	0.331	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.985	nucleus
GO:0032991	0.977	protein-containing complex
GO:0031974	0.967	membrane-enclosed lumen
GO:0031981	0.963	nuclear lumen
GO:0005654	0.939	nucleoplasm
GO:0043228	0.896	non-membrane-bounded organelle
GO:0043232	0.882	intracellular non-membrane-bounded organelle
GO:0036464	0.521	cytoplasmic ribonucleoprotein granule
GO:0035145	0.417	exon-exon junction complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]