StarFunc result for job id Q9HAV4

User Input

>input (1204 residues)
MAMDQVNALCEQLVKAVTVMMDPNSTQRYRLEALKFCEEFKEKCPICVPCGLRLAEKTQV
AIVRHFGLQILEHVVKFRWNGMSRLEKVYLKNSVMELIANGTLNILEEENHIKDALSRIV
VEMIKREWPQHWPDMLIELDTLSKQGETQTELVMFILLRLAEDVVTFQTLPPQRRRDIQQ
TLTQNMERIFSFLLNTLQENVNKYQQVKTDTSQESKAQANCRVGVAALNTLAGYIDWVSM
SHITAENCKLLEILCLLLNEQELQLGAAECLLIAVSRKGKLEDRKPLMVLFGDVAMHYIL
SAAQTADGGGLVEKHYVFLKRLCQVLCALGNQLCALLGADSDVETPSNFGKYLESFLAFT
THPSQFLRSSTQMTWGALFRHEILSRDPLLLAIIPKYLRASMTNLVKMGFPSKTDSPSCE
YSRFDFDSDEDFNAFFNSSRAQQGEVMRLACRLDPKTSFQMAGEWLKYQLSTFLDAGSVN
SCSAVGTGEGSLCSVFSPSFVQWEAMTLFLESVITQMFRTLNREEIPVNDGIELLQMVLN
FDTKDPLILSCVLTNVSALFPFVTYRPEFLPQVFSKLFSSVTFETVEESKAPRTRAVRNV
RRHACSSIIKMCRDYPQLVLPNFDMLYNHVKQLLSNELLLTQMEKCALMEALVLISNQFK
NYERQKVFLEELMAPVASIWLSQDMHRVLSDVDAFIAYVGTDQKSCDPGLEDPCGLNRAR
MSFCVYSILGVVKRTCWPTDLEEAKAGGFVVGYTSSGNPIFRNPCTEQILKLLDNLLALI
RTHNTLYAPEMLAKMAEPFTKALDMLDAEKSAILGLPQPLLELNDSPVFKTVLERMQRFF
STLYENCFHILGKAGPSMQQDFYTVEDLATQLLSSAFVNLNNIPDYRLRPMLRVFVKPLV
LFCPPEHYEALVSPILGPLFTYLHMRLSQKWQVINQRSLLCGEDEAADENPESQEMLEEQ
LVRMLTREVMDLITVCCVSKKGADHSSAPPADGDDEEMMATEVTPSAMAELTDLGKCLMK
HEDVCTALLITAFNSLAWKDTLSCQRTTSQLCWPLLKQVLSGTLLADAVTWLFTSVLKGL
QMHGQHDGCMASLVHLAFQIYEALRPRYLEIRAVMEQIPEIQKDSLDQFDCKLLNPSLQK
VADKRRKDQFKRLIAGCIGKPLGEQFRKEVHIKNLPSLFKKTKPMLETEVLDNDGGGLAT
IFEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5yu7A	0.844	0.905	0.000	1118	0.926	0.997	5yu7A.pdb.gz
2	AFDB:Q924C1	0.971	0.971	0.000	1204	0.877	0.877	Q924C1.pdb.gz	XPO5_MOUSE Exportin-5 OS=Mus musculus OX=10090 GN=Xpo5 PE=1 SV=1
3	AFDB:Q9HAV4	1.000	1.000	0.000	1204	1.000	1.000	Q9HAV4.pdb.gz	XPO5_HUMAN Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1
4	AFDB:Q9BP41	0.885	0.860	6.725E-65	1241	0.355	0.345	Q9BP41.pdb.gz	Q9BP41_DROME RanBP21 OS=Drosophila melanogaster OX=7227 GN=Ranbp21 PE=1 SV=1
5	AFDB:Q0WP44	0.776	0.777	6.502E-34	1202	0.208	0.209	Q0WP44.pdb.gz	HASTY_ARATH Protein HASTY 1 OS=Arabidopsis thaliana OX=3702 GN=HST1 PE=1 SV=1
6	AFDB:O14116	0.728	0.712	1.016E-30	1234	0.180	0.176	O14116.pdb.gz	YKX1_SCHPO Uncharacterized protein C328.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC328.01c PE=4 SV=2
7	AFDB:P52918	0.747	0.736	2.504E-28	1224	0.179	0.176	P52918.pdb.gz	MSN5_YEAST Protein MSN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSN5 PE=1 SV=1
8	AFDB:Q38AK6	0.592	0.689	7.199E-17	1010	0.135	0.160	Q38AK6.pdb.gz	Q38AK6_TRYB2 Exportin-1/Importin-beta-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3070 PE=4 SV=1
9	AFDB:Q7PC79	0.507	0.592	1.020E-16	988	0.121	0.148	Q7PC79.pdb.gz	XPOT_ARATH Exportin-T OS=Arabidopsis thaliana OX=3702 GN=PSD PE=2 SV=1
10	AFDB:Q586K4	0.364	0.360	5.628E-16	1219	0.139	0.137	Q586K4.pdb.gz	Q586K4_TRYB2 Exportin-T OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=25N14.145 PE=3 SV=1
11	AFDB:O43592	0.512	0.611	1.658E-15	962	0.135	0.169	O43592.pdb.gz	XPOT_HUMAN Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2
12	PDB:2xwuB	0.454	0.568	2.366E-14	910	0.139	0.184	2xwuB.pdb.gz
13	PDB:3wyfC	0.560	0.634	2.626E-14	1040	0.123	0.142	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
14	PDB:5uwuC	0.592	0.698	1.609E-13	998	0.124	0.149	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
15	PDB:3gjxA	0.512	0.579	2.053E-13	1041	0.143	0.165	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
16	PDB:6gx9A	0.449	0.546	8.875E-13	912	0.115	0.152	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
17	PDB:4c0qA	0.441	0.569	3.006E-12	871	0.111	0.154	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
18	PDB:3icqT	0.447	0.538	3.223E-12	949	0.129	0.163	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
19	PDB:3gb8A	0.465	0.562	8.856E-12	958	0.136	0.171	3gb8A.pdb.gz
20	PDB:2x1gF	0.412	0.519	7.407E-10	896	0.114	0.153	2x1gF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q924C1	0.0	2171	1204	0.877	0.877	XPO5_MOUSE Exportin-5 OS=Mus musculus OX=10090 GN=Xpo5 PE=1 SV=1
2	Q9BP41	0.0	707	1241	0.363	0.352	Q9BP41_DROME RanBP21 OS=Drosophila melanogaster OX=7227 GN=Ranbp21 PE=1 SV=1
3	Q9HAV4	0.0	2497	1204	1.000	1.000	XPO5_HUMAN Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1
4	H0Y3W3	3.39e-166	494	253	0.200	0.953	H0Y3W3_HUMAN Exportin 5 (Fragment) OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1
5	O14116	4.90e-32	138	1234	0.191	0.186	YKX1_SCHPO Uncharacterized protein C328.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC328.01c PE=4 SV=2
6	Q0WP44	2.26e-22	107	1202	0.121	0.121	HASTY_ARATH Protein HASTY 1 OS=Arabidopsis thaliana OX=3702 GN=HST1 PE=1 SV=1
7	P52918	1.76e-15	84.3	1224	0.125	0.123	MSN5_YEAST Protein MSN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSN5 PE=1 SV=1
8	Q5ZIV8	2.30e-11	68.6	300	0.042	0.167	Q5ZIV8_CHICK Importin N-terminal domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_23d16 PE=2 SV=1
9	F4IZR5	2.74e-11	70.9	1076	0.046	0.051	XPO1B_ARATH Protein EXPORTIN 1B OS=Arabidopsis thaliana OX=3702 GN=XPO1B PE=2 SV=1
10	Q9SMV6	4.30e-11	70.1	1075	0.042	0.047	XPO1A_ARATH Protein EXPORTIN 1A OS=Arabidopsis thaliana OX=3702 GN=XPO1 PE=1 SV=1
11	Q9PW90	1.17e-10	68.6	1071	0.042	0.047	Q9PW90_XENLA CRM1/XPO1 protein OS=Xenopus laevis OX=8355 PE=2 SV=1
12	O14980	1.19e-10	68.6	1071	0.042	0.047	XPO1_HUMAN Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1
13	Q6P5F9	1.26e-10	68.6	1071	0.042	0.047	XPO1_MOUSE Exportin-1 OS=Mus musculus OX=10090 GN=Xpo1 PE=1 SV=1
14	Q80U96	1.28e-10	68.6	1071	0.042	0.047	XPO1_RAT Exportin-1 OS=Rattus norvegicus OX=10116 GN=Xpo1 PE=1 SV=1
15	E7F0E8	1.99e-10	67.8	1071	0.042	0.047	E7F0E8_DANRE Exportin 1 (CRM1 homolog, yeast) a OS=Danio rerio OX=7955 GN=xpo1a PE=1 SV=2
16	C8VRM0	1.04e-08	62.4	1072	0.041	0.046	C8VRM0_EMENI Exportin 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01401 PE=3 SV=1
17	Q9TVM2	1.24e-08	62.0	1063	0.040	0.045	XPO1_DROME Exportin-1 OS=Drosophila melanogaster OX=7227 GN=emb PE=1 SV=1
18	O43592	2.30e-08	61.2	962	0.052	0.065	XPOT_HUMAN Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2
19	P14068	3.90e-07	57.0	1078	0.037	0.041	XPO1_SCHPO Exportin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xpo1 PE=1 SV=3
20	A0A1D8PRR9	4.07e-07	57.0	1079	0.037	0.042	A0A1D8PRR9_CANAL Exportin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRM1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19273 Exportin-5	8.5e-275	925.5	Exportin-5 family
2	PF03810 IBN_N	0.45	21.8	Importin-beta N-terminal domain
3	PF00443 UCH	7.5e+02	11.0	Ubiquitin carboxyl-terminal hydrolase
4	PF19963 VMAP-M1	4.5e+02	12.8	vWA-MoxR associated protein middle region (VMAP-M) 1
5	PF08389 Xpo1	2.9e-28	110.2	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265351

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000446215	0.999	GTP-binding nuclear protein Ran
2	9606.ENSP00000437256	0.998	Endoribonuclease Dicer
3	9606.ENSP00000220592	0.988	Protein argonaute-2
4	9606.ENSP00000404121	0.987	Interleukin enhancer-binding factor 3
5	9606.ENSP00000266987	0.983	RISC-loading complex subunit TARBP2
6	9606.ENSP00000362300	0.982	Protein argonaute-1
7	9606.ENSP00000425979	0.977	Ribonuclease 3
8	9606.ENSP00000263209	0.968	Microprocessor complex subunit DGCR8
9	9606.ENSP00000379144	0.968	Trinucleotide repeat-containing gene 6A protein
10	9606.ENSP00000478754	0.951	Probable ATP-dependent RNA helicase DDX6
11	9606.ENSP00000373715	0.940	m7GpppN-mRNA hydrolase
12	9606.ENSP00000425561	0.939	Eukaryotic translation initiation factor 4E
13	9606.ENSP00000356520	0.933	ATP-dependent RNA helicase A
14	9606.ENSP00000362306	0.927	Protein argonaute-4
15	9606.ENSP00000273317	0.900	LIM domain-containing protein 1
16	9606.ENSP00000352400	0.899	Nuclear pore complex protein Nup214
17	9606.ENSP00000362287	0.889	Protein argonaute-3
18	9606.ENSP00000401470	0.885	Ran GTPase-activating protein 1
19	9606.ENSP00000318176	0.884	Interferon-inducible double-stranded RNA-dependent protein kinase activator A
20	9606.ENSP00000401564	0.859	Ran-specific GTPase-activating protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005049	1.000	nuclear export signal receptor activity
GO:0003723	1.000	RNA binding
GO:0019899	0.971	enzyme binding
GO:0051020	0.886	GTPase binding
GO:0044877	0.877	protein-containing complex binding
GO:0031267	0.875	small GTPase binding
GO:0043021	0.870	ribonucleoprotein complex binding
GO:0003729	0.761	mRNA binding
GO:1905172	0.586	RISC complex binding
GO:0070883	0.558	pre-miRNA binding
GO:0000049	0.400	tRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0008104	0.955	protein localization
GO:0015031	0.945	protein transport
GO:0006886	0.943	intracellular protein transport
GO:0006611	0.920	protein export from nucleus
GO:0050789	0.904	regulation of biological process
GO:0071704	0.783	organic substance metabolic process
GO:0019222	0.671	regulation of metabolic process
GO:0043170	0.663	macromolecule metabolic process
GO:0060255	0.658	regulation of macromolecule metabolic process
GO:0048519	0.637	negative regulation of biological process
GO:0010468	0.582	regulation of gene expression
GO:0044237	0.541	cellular metabolic process
GO:0044238	0.534	primary metabolic process
GO:0010605	0.527	negative regulation of macromolecule metabolic process
GO:0006807	0.520	nitrogen compound metabolic process
GO:0034641	0.499	cellular nitrogen compound metabolic process
GO:0046483	0.482	heterocycle metabolic process
GO:0006725	0.466	cellular aromatic compound metabolic process
GO:0090304	0.463	nucleic acid metabolic process
GO:0048518	0.420	positive regulation of biological process
GO:0010629	0.416	negative regulation of gene expression
GO:0016070	0.381	RNA metabolic process
GO:0031047	0.319	RNA-mediated gene silencing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:1990904	0.997	ribonucleoprotein complex
GO:0016442	0.989	RISC complex
GO:0031074	0.981	nucleocytoplasmic transport complex
GO:0016020	0.831	membrane
GO:0012505	0.693	endomembrane system
GO:0140513	0.559	nuclear protein-containing complex
GO:0043232	0.544	intracellular non-membrane-bounded organelle
GO:0042565	0.526	RNA nuclear export complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]