StarFunc result for job id Q9HAV5

User Input

>input (297 residues)
MDCQENEYWDQWGRCVTCQRCGPGQELSKDCGYGEGGDAYCTACPPRRYKSSWGHHRCQS
CITCAVINRVQKVNCTATSNAVCGDCLPRFYRKTRIGGLQDQECIPCTKQTPTSEVQCAF
QLSLVEADTPTVPPQEATLVALVSSLLVVFTLAFLGLFFLYCKQFFNRHCQRGGLLQFEA
DKTAKEESLFPVPPSKETSAESQVSENIFQTQPLNPILEDDCSSTSGFPTQESFTMASCT
SESHSHWVHSPIECTELDLQKFSSSASYTGAETLGGNTVESTGDRLELNVPFEVPSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAV5	1.000	1.000	2.923E-51	297	1.000	1.000	Q9HAV5.pdb.gz	TNR27_HUMAN Tumor necrosis factor receptor superfamily member 27 OS=Homo sapiens OX=9606 GN=EDA2R PE=1 SV=2
2	AFDB:Q8BX35	0.510	0.510	2.513E-40	297	0.801	0.801	Q8BX35.pdb.gz	TNR27_MOUSE Tumor necrosis factor receptor superfamily member 27 OS=Mus musculus OX=10090 GN=Eda2r PE=2 SV=1
3	AFDB:Q9NS68	0.399	0.285	3.661E-22	423	0.327	0.229	Q9NS68.pdb.gz	TNR19_HUMAN Tumor necrosis factor receptor superfamily member 19 OS=Homo sapiens OX=9606 GN=TNFRSF19 PE=1 SV=1
4	AFDB:Q9JLL3	0.403	0.290	7.675E-21	416	0.296	0.212	Q9JLL3.pdb.gz	TNR19_MOUSE Tumor necrosis factor receptor superfamily member 19 OS=Mus musculus OX=10090 GN=Tnfrsf19 PE=1 SV=2
5	AFDB:Q1ECV9	0.400	0.336	4.879E-20	356	0.320	0.267	Q1ECV9.pdb.gz	Q1ECV9_DANRE TROY OS=Danio rerio OX=7955 GN=zgc:136805 PE=2 SV=1
6	AFDB:Q9R187	0.340	0.234	3.546E-11	448	0.215	0.143	Q9R187.pdb.gz	EDAR_MOUSE Tumor necrosis factor receptor superfamily member EDAR OS=Mus musculus OX=10090 GN=Edar PE=1 SV=1
7	AFDB:O19131	0.229	0.155	1.258E-7	471	0.229	0.144	O19131.pdb.gz	TNR1A_BOVIN Tumor necrosis factor receptor superfamily member 1A OS=Bos taurus OX=9913 GN=TNFRSF1A PE=2 SV=1
8	AFDB:P22934	0.230	0.158	2.424E-7	461	0.199	0.128	P22934.pdb.gz	TNR1A_RAT Tumor necrosis factor receptor superfamily member 1A OS=Rattus norvegicus OX=10116 GN=Tnfrsf1a PE=2 SV=2
9	AFDB:F1RAS9	0.223	0.165	1.636E-6	425	0.209	0.146	F1RAS9.pdb.gz	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
10	AFDB:P20333	0.227	0.157	1.617E-4	461	0.219	0.141	P20333.pdb.gz	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
11	PDB:7e9hR	0.118	0.052	9.744E-1	766	0.030	0.012	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
12	PDB:7dtvA	0.147	0.063	3.411	779	0.027	0.010	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
13	PDB:3sucA	0.086	0.046	4.080	767	0.030	0.012	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
14	PDB:5yzgY	0.132	0.186	4.080	204	0.071	0.103	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:1ho5A	0.062	0.045	5.835	525	0.020	0.011	1ho5A.pdb.gz	Mechanism of hydrolysis of phosphate esters by the dimetal center of 5'-nucleotidase based on crystal structures.
16	PDB:7ufgA	0.118	0.042	5.835	1151	0.077	0.020	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:1um0A	0.065	0.054	6.194	365	0.034	0.027	1um0A.pdb.gz	Crystal structure of chorismate synthase: a novel FMN-binding protein fold and functional insights
18	PDB:2h32A	0.067	0.148	6.194	111	0.017	0.045	2h32A.pdb.gz	Structural Insight into Pre-B Cell Receptor Function
19	PDB:2kniA	0.075	0.415	6.979	41	0.027	0.195	2kniA.pdb.gz
20	PDB:4zzlA	0.072	0.115	6.979	146	0.037	0.075	4zzlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HAV5	0.0	613	297	1.000	1.000	TNR27_HUMAN Tumor necrosis factor receptor superfamily member 27 OS=Homo sapiens OX=9606 GN=EDA2R PE=1 SV=2
2	Q8BX35	2.03e-179	498	297	0.801	0.801	TNR27_MOUSE Tumor necrosis factor receptor superfamily member 27 OS=Mus musculus OX=10090 GN=Eda2r PE=2 SV=1
3	Q9NS68	5.57e-48	167	423	0.269	0.189	TNR19_HUMAN Tumor necrosis factor receptor superfamily member 19 OS=Homo sapiens OX=9606 GN=TNFRSF19 PE=1 SV=1
4	Q9JLL3	2.92e-47	165	416	0.263	0.188	TNR19_MOUSE Tumor necrosis factor receptor superfamily member 19 OS=Mus musculus OX=10090 GN=Tnfrsf19 PE=1 SV=2
5	Q1ECV9	9.12e-47	162	356	0.249	0.208	Q1ECV9_DANRE TROY OS=Danio rerio OX=7955 GN=zgc:136805 PE=2 SV=1
6	Q9UNE0	4.64e-09	59.3	448	0.168	0.112	EDAR_HUMAN Tumor necrosis factor receptor superfamily member EDAR OS=Homo sapiens OX=9606 GN=EDAR PE=1 SV=1
7	Q9R187	1.88e-07	54.3	448	0.145	0.096	EDAR_MOUSE Tumor necrosis factor receptor superfamily member EDAR OS=Mus musculus OX=10090 GN=Edar PE=1 SV=1
8	Q8BX43	3.52e-07	53.5	436	0.104	0.071	TR19L_MOUSE Tumor necrosis factor receptor superfamily member 19L OS=Mus musculus OX=10090 GN=Relt PE=1 SV=2
9	A0A0R4IGE7	7.47e-07	52.4	460	0.145	0.093	A0A0R4IGE7_DANRE Ectodysplasin A receptor OS=Danio rerio OX=7955 GN=fls PE=4 SV=1
10	Q969Z4	1.47e-06	51.6	430	0.098	0.067	TR19L_HUMAN Tumor necrosis factor receptor superfamily member 19L OS=Homo sapiens OX=9606 GN=RELT PE=1 SV=1
11	Q501W2	0.001	41.6	251	0.155	0.183	Q501W2_RAT CD27 molecule OS=Rattus norvegicus OX=10116 GN=Cd27 PE=2 SV=1
12	Q6NUU6	0.001	42.4	389	0.118	0.090	Q6NUU6_DANRE Tumor necrosis factor receptor superfamily member 1A precursor OS=Danio rerio OX=7955 GN=zgc:85914 PE=2 SV=1
13	P26842	0.004	40.4	260	0.114	0.131	CD27_HUMAN CD27 antigen OS=Homo sapiens OX=9606 GN=CD27 PE=1 SV=2
14	F1RAS9	0.005	40.4	425	0.104	0.073	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
15	Q8V2D1	0.019	37.7	175	0.108	0.183	Q8V2D1_HCMV UL144 protein OS=Human cytomegalovirus OX=10359 PE=1 SV=1
16	F1RII3	0.024	38.1	246	0.071	0.085	F1RII3_PIG TNF receptor superfamily member 9 OS=Sus scrofa OX=9823 GN=TNFRSF9 PE=4 SV=3
17	O08727	0.026	38.1	401	0.084	0.062	TR11B_RAT Tumor necrosis factor receptor superfamily member 11B OS=Rattus norvegicus OX=10116 GN=Tnfrsf11b PE=2 SV=1
18	I2E6E0	0.028	37.7	241	0.071	0.087	I2E6E0_PIG 4-1BB variant 2 OS=Sus scrofa OX=9823 PE=2 SV=1
19	P50284	0.031	38.1	415	0.088	0.063	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
20	P25119	0.035	38.1	474	0.088	0.055	TNR1B_MOUSE Tumor necrosis factor receptor superfamily member 1B OS=Mus musculus OX=10090 GN=Tnfrsf1b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00020 TNFR_c6	2.9e-08	45.3	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000000656

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021805	0.913	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
2	61853.ENSNLEP00000000845	0.828	Uncharacterized protein
3	61853.ENSNLEP00000000848	0.828	Uncharacterized protein
4	61853.ENSNLEP00000007193	0.582	Solute carrier family 24 (sodium/potassium/calcium exchanger), member 5
5	61853.ENSNLEP00000019474	0.577	Belongs to the TNF receptor-associated factor family.
6	61853.ENSNLEP00000017379	0.572	Solute carrier family 45, member 2
7	61853.ENSNLEP00000011298	0.547	Transglutaminase 3
8	61853.ENSNLEP00000003928	0.522	EDAR-associated death domain
9	61853.ENSNLEP00000022564	0.520	NHL repeat containing E3 ubiquitin protein ligase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0048584	0.981	positive regulation of response to stimulus
GO:0065009	0.979	regulation of molecular function
GO:0080090	0.977	regulation of primary metabolic process
GO:1902531	0.965	regulation of intracellular signal transduction
GO:0009967	0.962	positive regulation of signal transduction
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0031323	0.951	regulation of cellular metabolic process
GO:0010468	0.948	regulation of gene expression
GO:0010556	0.940	regulation of macromolecule biosynthetic process
GO:0031326	0.940	regulation of cellular biosynthetic process
GO:0019219	0.939	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.932	regulation of DNA-templated transcription
GO:1902533	0.907	positive regulation of intracellular signal transduction
GO:0050896	0.889	response to stimulus
GO:0051090	0.886	regulation of DNA-binding transcription factor activity
GO:0032502	0.875	developmental process
GO:0048856	0.874	anatomical structure development
GO:0044093	0.839	positive regulation of molecular function
GO:0051716	0.809	cellular response to stimulus
GO:0080134	0.741	regulation of response to stress
GO:0007154	0.719	cell communication
GO:0023052	0.718	signaling
GO:0007165	0.707	signal transduction
GO:0009888	0.695	tissue development
GO:0051091	0.610	positive regulation of DNA-binding transcription factor activity
GO:0051092	0.580	positive regulation of NF-kappaB transcription factor activity
GO:0007398	0.564	ectoderm development
GO:0043408	0.495	regulation of MAPK cascade
GO:0035556	0.414	intracellular signal transduction
GO:0097190	0.400	apoptotic signaling pathway
GO:0080135	0.396	regulation of cellular response to stress
GO:0072331	0.345	signal transduction by p53 class mediator
GO:0043410	0.345	positive regulation of MAPK cascade
GO:0097193	0.340	intrinsic apoptotic signaling pathway
GO:0070302	0.311	regulation of stress-activated protein kinase signaling cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.729	intracellular anatomical structure
GO:0043231	0.378	intracellular membrane-bounded organelle
GO:0005737	0.367	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]