StarFunc result for job id Q9HAV7

User Input

>input (217 residues)
MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTL
LEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEK
ATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFH
TPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAV7	1.000	1.000	5.021E-37	217	1.000	1.000	Q9HAV7.pdb.gz	GRPE1_HUMAN GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2
2	AFDB:P97576	0.817	0.817	5.530E-34	217	0.885	0.885	P97576.pdb.gz	GRPE1_RAT GrpE protein homolog 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Grpel1 PE=1 SV=2
3	AFDB:P48604	0.751	0.765	1.201E-21	213	0.447	0.455	P48604.pdb.gz	GRPE_DROME GrpE protein homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Roe1 PE=2 SV=2
4	AFDB:Q8TAA5	0.753	0.726	1.240E-20	225	0.415	0.400	Q8TAA5.pdb.gz	GRPE2_HUMAN GrpE protein homolog 2, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL2 PE=1 SV=1
5	AFDB:O88396	0.734	0.712	3.500E-20	224	0.396	0.384	O88396.pdb.gz	GRPE2_MOUSE GrpE protein homolog 2, mitochondrial OS=Mus musculus OX=10090 GN=Grpel2 PE=2 SV=2
6	AFDB:P38523	0.737	0.702	3.499E-18	228	0.323	0.307	P38523.pdb.gz	GRPE_YEAST GrpE protein homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGE1 PE=1 SV=1
7	AFDB:Q8IIB6	0.686	0.501	2.974E-17	301	0.341	0.246	Q8IIB6.pdb.gz	Q8IIB6_PLAF7 GrpE protein homolog OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1124700 PE=3 SV=2
8	AFDB:Q8LB47	0.681	0.461	3.174E-17	327	0.346	0.229	Q8LB47.pdb.gz	MGE2_ARATH GrpE protein homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge2 PE=1 SV=1
9	AFDB:Q9FLP3	0.678	0.497	8.958E-17	302	0.332	0.238	Q9FLP3.pdb.gz	MGE1_ARATH GrpE protein homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge1 PE=2 SV=1
10	AFDB:Q18421	0.678	0.624	1.713E-16	237	0.313	0.287	Q18421.pdb.gz	GRPE_CAEEL GrpE protein homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=C34C12.8 PE=3 SV=1
11	PDB:1dkgA	0.671	0.906	4.632E-11	158	0.194	0.266	1dkgA.pdb.gz
12	PDB:4txzB	0.148	0.097	4.931E-1	366	0.088	0.052	4txzB.pdb.gz	Structure-Guided Reprogramming of Human cGAS Dinucleotide Linkage Specificity.
13	PDB:4xj6A	0.114	0.080	1.485	370	0.111	0.065	4xj6A.pdb.gz	Structural Basis for the Catalytic Mechanism of DncV, Bacterial Homolog of Cyclic GMP-AMP Synthase
14	PDB:2hyeA	0.079	0.025	1.585	1140	0.028	0.005	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
15	PDB:4u03A	0.155	0.094	2.495	389	0.060	0.033	4u03A.pdb.gz	Structural Biochemistry of a Vibrio cholerae Dinucleotide Cyclase Reveals Cyclase Activity Regulation by Folates.
16	PDB:2avoA	0.098	0.166	3.234	99	0.028	0.061	2avoA.pdb.gz	Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S.
17	PDB:6dk4A	0.127	0.170	3.928	135	0.069	0.111	6dk4A.pdb.gz	Crystal structure of Campylobacter jejuni peroxide regulator.
18	PDB:5hrfA	0.092	0.107	5.092	178	0.032	0.039	5hrfA.pdb.gz	The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
19	PDB:1u2mC	0.201	0.268	5.433	143	0.046	0.070	1u2mC.pdb.gz
20	PDB:1p9kA	0.066	0.158	5.797	79	0.014	0.038	1p9kA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HAV7	1.77e-158	438	217	1.000	1.000	GRPE1_HUMAN GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2
2	P97576	4.35e-142	397	217	0.885	0.885	GRPE1_RAT GrpE protein homolog 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Grpel1 PE=1 SV=2
3	Q99LP6	4.85e-142	397	217	0.880	0.880	GRPE1_MOUSE GrpE protein homolog 1, mitochondrial OS=Mus musculus OX=10090 GN=Grpel1 PE=1 SV=1
4	Q8TAA5	6.74e-56	179	225	0.447	0.431	GRPE2_HUMAN GrpE protein homolog 2, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL2 PE=1 SV=1
5	P48604	1.60e-55	177	213	0.465	0.474	GRPE_DROME GrpE protein homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Roe1 PE=2 SV=2
6	O88396	2.99e-52	169	224	0.415	0.402	GRPE2_MOUSE GrpE protein homolog 2, mitochondrial OS=Mus musculus OX=10090 GN=Grpel2 PE=2 SV=2
7	Q18421	4.69e-41	141	237	0.327	0.300	GRPE_CAEEL GrpE protein homolog, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=C34C12.8 PE=3 SV=1
8	Q8IIB6	7.68e-35	127	301	0.327	0.236	Q8IIB6_PLAF7 GrpE protein homolog OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1124700 PE=3 SV=2
9	P38523	2.86e-30	113	228	0.286	0.272	GRPE_YEAST GrpE protein homolog, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MGE1 PE=1 SV=1
10	Q9FLP3	5.65e-30	114	302	0.290	0.209	MGE1_ARATH GrpE protein homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge1 PE=2 SV=1
11	Q8LB47	6.35e-29	112	327	0.290	0.193	MGE2_ARATH GrpE protein homolog 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge2 PE=1 SV=1
12	C4ZYN1	1.32e-16	77.0	197	0.235	0.259	GRPE_ECOBW Protein GrpE OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=grpE PE=1 SV=1
13	P09372	1.32e-16	77.0	197	0.235	0.259	GRPE_ECOLI Protein GrpE OS=Escherichia coli (strain K12) OX=83333 GN=grpE PE=1 SV=1
14	P28609	4.80e-11	61.6	187	0.221	0.257	GRPE_BORBU Protein GrpE OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=grpE PE=3 SV=1
15	D6RGI6	6.25e-10	57.4	128	0.147	0.250	D6RGI6_HUMAN GrpE like 2, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL2 PE=1 SV=1
16	Q97S73	1.71e-09	57.0	174	0.212	0.264	GRPE_STRPN Protein GrpE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=grpE PE=1 SV=1
17	A0A178U8H4	3.16e-07	52.0	326	0.217	0.144	A0A178U8H4_ARATH GrpE protein homolog OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g17430 PE=1 SV=1
18	Q9XQC7	3.16e-07	52.0	326	0.217	0.144	Q9XQC7_ARATH GrpE protein homolog OS=Arabidopsis thaliana OX=3702 GN=EMB1241 PE=1 SV=1
19	Q9CGY9	4.28e-04	42.0	179	0.175	0.212	GRPE_LACLA Protein GrpE OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=grpE PE=3 SV=1
20	P9WMT5	6.89e-04	42.0	235	0.194	0.179	GRPE_MYCTU Protein GrpE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=grpE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10303 DUF2408	3.5e+02	13.2	Protein of unknown function (DUF2408)
2	PF01025 GrpE	5.4e-40	148.3	GrpE
3	PF18644 Phage_int_SAM_6	3.7e+02	12.5	Phage integrase SAM-like domain
4	PF04136 Sec34	5.4e+02	11.9	Sec34-like family
5	PF09432 THP2	2.3e+02	13.2	Tho complex subunit THP2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264954

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270538	0.999	Mitochondrial import inner membrane translocase subunit TIM44
2	9606.ENSP00000297185	0.999	Stress-70 protein, mitochondrial
3	9606.ENSP00000302961	0.991	Heat shock protein family A member 4
4	9606.ENSP00000373620	0.987	60 kDa heat shock protein, mitochondrial
5	9606.ENSP00000294053	0.986	Caseinolytic peptidase B protein homolog
6	9606.ENSP00000315693	0.984	Mitochondrial import inner membrane translocase subunit TIM16
7	9606.ENSP00000372005	0.978	Mitochondrial import inner membrane translocase subunit TIM14
8	9606.ENSP00000233893	0.968	10 kDa heat shock protein, mitochondrial
9	9606.ENSP00000356256	0.965	Mitochondrial import inner membrane translocase subunit Tim17-A
10	9606.ENSP00000257245	0.961	Mitochondrial import inner membrane translocase subunit Tim10
11	9606.ENSP00000254322	0.957	DnaJ homolog subfamily B member 1
12	9606.ENSP00000262375	0.955	DnaJ homolog subfamily A member 3, mitochondrial
13	9606.ENSP00000216027	0.947	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
14	9606.ENSP00000368523	0.943	DnaJ homolog subfamily C member 15
15	9606.ENSP00000249269	0.942	Mitochondrial-processing peptidase subunit beta
16	9606.ENSP00000329558	0.933	GrpE protein homolog 2, mitochondrial
17	9606.ENSP00000360782	0.920	Mitochondrial-processing peptidase subunit alpha
18	9606.ENSP00000432083	0.917	Heat shock cognate 71 kDa protein
19	9606.ENSP00000379999	0.904	Translocase of inner mitochondrial membrane 17B
20	9606.ENSP00000300107	0.900	ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0051082	0.999	unfolded protein binding
GO:0098772	0.903	molecular function regulator activity
GO:0060590	0.727	ATPase regulator activity
GO:1901363	0.353	heterocyclic compound binding
GO:0097159	0.351	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0016043	0.948	cellular component organization
GO:0065007	0.884	biological regulation
GO:0050896	0.782	response to stimulus
GO:0050789	0.697	regulation of biological process
GO:0008152	0.508	metabolic process
GO:0050794	0.478	regulation of cellular process
GO:0007005	0.451	mitochondrion organization
GO:0071704	0.426	organic substance metabolic process
GO:0044238	0.332	primary metabolic process
GO:0006807	0.326	nitrogen compound metabolic process
GO:0044237	0.317	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.950	intracellular organelle lumen
GO:0005634	0.559	nucleus
GO:0031981	0.525	nuclear lumen
GO:0005654	0.459	nucleoplasm
GO:0005759	0.384	mitochondrial matrix
GO:0016020	0.363	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]