StarFunc result for job id Q9HAW0

User Input

>input (419 residues)
MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTG
ENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGC
CVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSF
KLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPA
DRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDL
LQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPP
CMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAW0	1.000	1.000	1.336E-60	419	1.000	1.000	Q9HAW0.pdb.gz	BRF2_HUMAN Transcription factor IIIB 50 kDa subunit OS=Homo sapiens OX=9606 GN=BRF2 PE=1 SV=1
2	AFDB:Q54U85	0.404	0.249	5.011E-12	706	0.143	0.085	Q54U85.pdb.gz	Q54U85_DICDI TATA box-binding protein-associated factor, RNA polymerase III, subunit 2 OS=Dictyostelium discoideum OX=44689 GN=brf1 PE=4 SV=1
3	AFDB:F1R9S3	0.423	0.279	5.751E-12	661	0.167	0.106	F1R9S3.pdb.gz	F1R9S3_DANRE B-related factor 1 OS=Danio rerio OX=7955 GN=brf1 PE=3 SV=1
4	AFDB:Q92994	0.430	0.276	1.654E-11	677	0.198	0.123	Q92994.pdb.gz	TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens OX=9606 GN=BRF1 PE=1 SV=1
5	AFDB:Q9P6R0	0.435	0.380	1.732E-11	492	0.177	0.150	Q9P6R0.pdb.gz	TF3B_SCHPO Transcription factor IIIB 60 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brf1 PE=1 SV=2
6	AFDB:Q9NB72	0.397	0.261	2.389E-11	662	0.179	0.113	Q9NB72.pdb.gz	Q9NB72_DROME B-related factor 1 OS=Drosophila melanogaster OX=7227 GN=Brf PE=2 SV=1
7	AFDB:P29056	0.477	0.348	6.267E-11	596	0.181	0.128	P29056.pdb.gz	TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRF1 PE=1 SV=1
8	AFDB:Q5TZ89	0.435	0.275	9.476E-11	693	0.179	0.108	Q5TZ89.pdb.gz
9	AFDB:O81787	0.451	0.366	4.729E-10	527	0.172	0.137	O81787.pdb.gz	PTF2_ARATH Plant-specific TFIIB-related protein PTF2 OS=Arabidopsis thaliana OX=3702 GN=PTF2 PE=1 SV=1
10	AFDB:Q0WVQ3	0.413	0.303	3.256E-9	604	0.165	0.114	Q0WVQ3.pdb.gz	Q0WVQ3_ARATH Cyclin/Brf1-like TBP-binding protein OS=Arabidopsis thaliana OX=3702 GN=BRF2 PE=1 SV=1
11	PDB:5iy6M	0.406	0.633	4.315E-8	260	0.124	0.200	5iy6M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
12	PDB:5iy7M	0.400	0.523	6.231E-8	310	0.134	0.181	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
13	PDB:6eu0Z	0.377	0.458	1.125E-6	339	0.112	0.139	6eu0Z.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
14	PDB:7zs9M	0.399	0.524	4.072E-6	310	0.117	0.158	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
15	PDB:7ml4M	0.366	0.617	5.124E-6	234	0.112	0.201	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
16	PDB:4v1nM	0.348	0.476	1.119E-5	299	0.112	0.157	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
17	PDB:7kpvB	0.206	0.288	6.370E-4	290	0.095	0.138	7kpvB.pdb.gz
18	PDB:1zp2A	0.213	0.378	2.202E-3	227	0.069	0.128	1zp2A.pdb.gz
19	PDB:7kueB	0.216	0.384	2.900E-3	225	0.057	0.107	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
20	PDB:7b5lY	0.210	0.339	4.385E-3	253	0.076	0.126	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HAW0	0.0	859	419	1.000	1.000	BRF2_HUMAN Transcription factor IIIB 50 kDa subunit OS=Homo sapiens OX=9606 GN=BRF2 PE=1 SV=1
2	Q9P6R0	8.59e-09	59.7	492	0.136	0.116	TF3B_SCHPO Transcription factor IIIB 60 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brf1 PE=1 SV=2
3	P62915	2.90e-08	57.4	316	0.143	0.190	TF2B_MOUSE Transcription initiation factor IIB OS=Mus musculus OX=10090 GN=Gtf2b PE=1 SV=1
4	Q00403	3.14e-08	57.4	316	0.143	0.190	TF2B_HUMAN Transcription initiation factor IIB OS=Homo sapiens OX=9606 GN=GTF2B PE=1 SV=1
5	P29056	7.55e-08	57.0	596	0.193	0.136	TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRF1 PE=1 SV=1
6	P29052	2.73e-07	54.3	315	0.131	0.175	TF2B_DROME Transcription initiation factor IIB OS=Drosophila melanogaster OX=7227 GN=TfIIB PE=2 SV=1
7	F1R9S3	3.80e-07	54.7	661	0.129	0.082	F1R9S3_DANRE B-related factor 1 OS=Danio rerio OX=7955 GN=brf1 PE=3 SV=1
8	Q802Z8	3.83e-07	54.7	661	0.129	0.082	Q802Z8_DANRE B-related factor 1 OS=Danio rerio OX=7955 GN=brf1 PE=2 SV=1
9	Q92994	5.30e-07	54.3	677	0.136	0.084	TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens OX=9606 GN=BRF1 PE=1 SV=1
10	Q8CFK2	8.79e-07	53.5	676	0.129	0.080	TF3B_MOUSE Transcription factor IIIB 90 kDa subunit OS=Mus musculus OX=10090 GN=Brf1 PE=1 SV=1
11	O13749	1.65e-06	52.0	340	0.091	0.112	TF2B_SCHPO Transcription initiation factor IIB OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sua7 PE=3 SV=1
12	Q54U85	3.83e-06	51.6	706	0.095	0.057	Q54U85_DICDI TATA box-binding protein-associated factor, RNA polymerase III, subunit 2 OS=Dictyostelium discoideum OX=44689 GN=brf1 PE=4 SV=1
13	Q6P9Z3	3.94e-06	51.6	693	0.124	0.075	Q6P9Z3_DANRE B-related factor 1 OS=Danio rerio OX=7955 GN=zgc:63497 PE=2 SV=1
14	Q9SS44	5.22e-06	50.4	312	0.150	0.202	TF2B2_ARATH Transcription initiation factor IIB-2 OS=Arabidopsis thaliana OX=3702 GN=TFIIB2 PE=2 SV=1
15	P48512	2.50e-05	48.1	312	0.143	0.192	TF2B1_ARATH Transcription initiation factor IIB-1 OS=Arabidopsis thaliana OX=3702 GN=TFIIB1 PE=1 SV=1
16	B1APE2	2.00e-04	45.1	231	0.100	0.182	B1APE2_HUMAN Transcription initiation factor IIB (Fragment) OS=Homo sapiens OX=9606 GN=GTF2B PE=1 SV=1
17	B1APE1	0.010	39.7	224	0.088	0.165	B1APE1_HUMAN Transcription initiation factor IIB (Fragment) OS=Homo sapiens OX=9606 GN=GTF2B PE=1 SV=1
18	O81787	0.011	40.4	527	0.110	0.087	PTF2_ARATH Plant-specific TFIIB-related protein PTF2 OS=Arabidopsis thaliana OX=3702 GN=PTF2 PE=1 SV=1
19	Q9M2L0	0.012	40.0	360	0.088	0.103	Q9M2L0_ARATH TFIIB4 OS=Arabidopsis thaliana OX=3702 GN=F28O9.220 PE=2 SV=1
20	Q0WVQ3	0.033	38.9	604	0.117	0.081	Q0WVQ3_ARATH Cyclin/Brf1-like TBP-binding protein OS=Arabidopsis thaliana OX=3702 GN=BRF2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08792 A2L_zn_ribbon	85	14.3	A2L zinc ribbon domain
2	PF14354 Lar_restr_allev	13	17.4	Restriction alleviation protein Lar
3	PF01667 Ribosomal_S27e	6.1e+02	11.5	Ribosomal protein S27
4	PF00382 TFIIB	2.1e-05	35.8	Transcription factor TFIIB repeat
5	PF08271 TF_Zn_Ribbon	0.00026	31.7	TFIIB zinc-binding
6	PF13719 zinc_ribbon_5	3.5e+02	12.4	zinc-ribbon domain
7	PF12760 Zn_Tnp_IS1595	7.7e+02	11.4	Transposase zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220659

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351575	0.998	Transcription factor TFIIIB component B'' homolog
2	9606.ENSP00000375942	0.996	TATA-box-binding protein
3	9606.ENSP00000366828	0.974	DNA-directed RNA polymerase III subunit RPC6
4	9606.ENSP00000263956	0.950	General transcription factor 3C polypeptide 3
5	9606.ENSP00000380904	0.914	DNA-directed RNA polymerase III subunit RPC4
6	9606.ENSP00000228347	0.910	DNA-directed RNA polymerase III subunit RPC2
7	9606.ENSP00000361446	0.895	DNA-directed RNA polymerase III subunit RPC1
8	9606.ENSP00000347345	0.892	DNA-directed RNA polymerase III subunit RPC8
9	9606.ENSP00000247219	0.885	TATA box-binding protein-like protein 2
10	9606.ENSP00000361465	0.882	DNA-directed RNA polymerases I and III subunit RPAC1
11	9606.ENSP00000216294	0.879	snRNA-activating protein complex subunit 1
12	9606.ENSP00000334564	0.878	DNA-directed RNA polymerase III subunit RPC3
13	9606.ENSP00000302478	0.876	DNA-directed RNA polymerases I and III subunit RPAC2
14	9606.ENSP00000478303	0.850	DNA-directed RNA polymerases I, II, and III subunit RPABC1
15	9606.ENSP00000403852	0.848	DNA-directed RNA polymerases I, II, and III subunit RPABC2
16	9606.ENSP00000342889	0.847	DNA-directed RNA polymerases I, II, and III subunit RPABC4
17	9606.ENSP00000299853	0.844	DNA-directed RNA polymerase III subunit RPC5
18	9606.ENSP00000378736	0.842	DNA-directed RNA polymerase III subunit RPC9
19	9606.ENSP00000415536	0.838	DNA-directed RNA polymerases I, II, and III subunit RPABC3
20	9606.ENSP00000293860	0.826	DNA-directed RNA polymerase III subunit RPC10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000992	1.000	RNA polymerase III cis-regulatory region sequence-specific DNA binding
GO:0001006	0.992	RNA polymerase III type 3 promoter sequence-specific DNA binding
GO:0005515	0.900	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006979	0.993	response to oxidative stress
GO:0062197	0.992	cellular response to chemical stress
GO:0006359	0.990	regulation of transcription by RNA polymerase III
GO:0034599	0.975	cellular response to oxidative stress
GO:0008152	0.636	metabolic process
GO:0071704	0.624	organic substance metabolic process
GO:0006807	0.599	nitrogen compound metabolic process
GO:0044237	0.577	cellular metabolic process
GO:0034641	0.523	cellular nitrogen compound metabolic process
GO:0046483	0.518	heterocycle metabolic process
GO:1901360	0.510	organic cyclic compound metabolic process
GO:0006725	0.505	cellular aromatic compound metabolic process
GO:0044238	0.383	primary metabolic process
GO:0043170	0.373	macromolecule metabolic process
GO:0090304	0.336	nucleic acid metabolic process
GO:0010467	0.300	gene expression
GO:0009059	0.300	macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005667	0.998	transcription regulator complex
GO:0090576	0.994	RNA polymerase III transcription regulator complex
GO:0000126	0.749	transcription factor TFIIIB complex
GO:0140513	0.734	nuclear protein-containing complex
GO:0043232	0.394	intracellular non-membrane-bounded organelle
GO:0005737	0.328	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]