StarFunc result for job id Q9HAW4

User Input

>input (1339 residues)
MTGEVGSEVHLEINDPNVISQEEADSPSDSGQGSYETIGPLSEGDSDEEIFVSKKLKNRK
VLQDSDSETEDTNASPEKTTYDSAEEENKENLYAGKNTKIKRIYKTVADSDESYMEKSLY
QENLEAQVKPCLELSLQSGNSTDFTTDRKSSKKHIHDKEGTAGKAKVKSKRRLEKEERKM
EKIRQLKKKETKNQEDDVEQPFNDSGCLLVDKDLFETGLEDENNSPLEDEESLESIRAAV
KNKVKKHKKKEPSLESGVHSFEEGSELSKGTTRKERKAARLSKEALKQLHSETQRLIRES
ALNLPYHMPENKTIHDFFKRKPRPTCHGNAMALLKSSKYQSSHHKEIIDTANTTEMNSDH
HSKGSEQTTGAENEVETNALPVVSKETQIITGSDESCRKDLVKNEELEIQEKQKQSDIRP
SPGDSSVLQQESNFLGNNHSEECQVGGLVAFEPHALEGEGPQNPEETDEKVEEPEQQNKS
SAVGPPEKVRRFTLDRLKQLGVDVSIKPRLGADEDSFVILEPETNRELEALKQRFWKHAN
PAAKPRAGQTVNVNVIVKDMGTDGKEELKADVVPVTLAPKKLDGASHTKPGEKLQVLKAK
LQEAMKLRRFEERQKRQALFKLDNEDGFEEEEEEEEEMTDESEEDGEEKVEKEEKEEELE
EEEEKEEEEEEEGNQETAEFLLSSEEIETKDEKEMDKENNDGSSEIGKAVGFLSVPKSLS
SDSTLLLFKDSSSKMGYFPTEEKSETDENSGKQPSKLDEDDSCSLLTKESSHNSSFELIG
STIPSYQPCNRQTGRGTSFFPTAGGFRSPSPGLFRASLVSSASKSSGKLSEPSLPIEDSQ
DLYNASPEPKTLFLGAGDFQFCLEDDTQSQLLDADGFLNVRNHRNQYQALKPRLPLASMD
ENAMDANMDELLDLCTGKFTSQAEKHLPRKSDKKENMEELLNLCSGKFTSQDASTPASSE
LNKQEKESSMGDPMEEALALCSGSFPTDKEEEDEEEEFGDFRLVSNDNEFDSDEDEHSDS
GNDLALEDHEDDDEEELLKRSEKLKRQMRLRKYLEDEAEVSGSDVGSEDEYDGEEIDEYE
EDVIDEVLPSDEELQSQIKKIHMKTMLDDDKRQLRLYQERYLADGDLHSDGPGRMRKFRW
KNIDDASQMDLFHRDSDDDQTEEQLDESEARWRKERIEREQWLRDMAQQGKITAEEEEEI
GEDSQFMILAKKVTAKALQKNASRPMVIQESKSLLRNPFEAIRPGSAQQVKTGSLLNQPK
AVLQKLAALSDHNPSAPRNSRNFVFHTLSPVKAEAAKESSKSQVKKRGPSFMTSPSPKHL
KTDDSTSGLTRSIFKYLES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAW4	0.999	0.999	0.000	1339	1.000	1.000	Q9HAW4.pdb.gz	CLSPN_HUMAN Claspin OS=Homo sapiens OX=9606 GN=CLSPN PE=1 SV=3
2	AFDB:Q8IRB5	0.086	0.082	5.630E-14	1465	0.188	0.172	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
3	AFDB:E9PYF4	0.050	0.043	1.861E-5	1699	0.158	0.124	E9PYF4.pdb.gz	E9PYF4_MOUSE LIM domain only 7 OS=Mus musculus OX=10090 GN=Lmo7 PE=1 SV=1
4	AFDB:Q9VXJ5	0.036	0.037	2.267E-4	1311	0.134	0.137	Q9VXJ5.pdb.gz	Q9VXJ5_DROME Disco-related, isoform A OS=Drosophila melanogaster OX=7227 GN=disco-r PE=4 SV=3
5	AFDB:Q09MP3	0.042	0.047	2.930E-4	1159	0.124	0.143	Q09MP3.pdb.gz	R51A2_HUMAN RAD51-associated protein 2 OS=Homo sapiens OX=9606 GN=RAD51AP2 PE=1 SV=1
6	AFDB:P97347	0.048	0.055	6.741E-4	1118	0.118	0.141	P97347.pdb.gz	RPTN_MOUSE Repetin OS=Mus musculus OX=10090 GN=Rptn PE=2 SV=2
7	AFDB:Q8IWB4	0.037	0.037	7.664E-4	1347	0.131	0.130	Q8IWB4.pdb.gz	S31A7_HUMAN Spermatogenesis-associated protein 31A7 OS=Homo sapiens OX=9606 GN=SPATA31A7 PE=1 SV=4
8	AFDB:Q3LHL9	0.040	0.034	2.430E-3	1658	0.108	0.087	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
9	AFDB:B0LVF0	0.051	0.054	3.806E-3	1219	0.129	0.142	B0LVF0.pdb.gz	B0LVF0_DANRE SIP1b OS=Danio rerio OX=7955 GN=zfhx1b PE=2 SV=1
10	AFDB:A0A2R8QDL5	0.052	0.057	4.613E-3	1191	0.128	0.144	A0A2R8QDL5.pdb.gz
11	PDB:1dw9A	0.024	0.148	3.543E-1	156	0.010	0.090	1dw9A.pdb.gz
12	PDB:7pfoQ	0.026	0.315	4.028E-1	79	0.034	0.582	7pfoQ.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
13	PDB:2g3aA	0.019	0.138	8.153E-1	137	0.010	0.095	2g3aA.pdb.gz
14	PDB:6j6qF	0.027	0.216	9.269E-1	161	0.015	0.124	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
15	PDB:7ohaM	0.025	0.163	9.269E-1	107	0.007	0.093	7ohaM.pdb.gz	Structures and implications of TBP-nucleosome complexes.
16	PDB:7eghA	0.027	0.050	1.277	630	0.010	0.022	7eghA.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
17	PDB:2xwnB	0.021	0.087	1.650	227	0.007	0.044	2xwnB.pdb.gz	Structural and Functional Studies on Mycobacterial Ispd Enzymes
18	PDB:4mqwB	0.022	0.169	1.760	109	0.007	0.092	4mqwB.pdb.gz
19	PDB:6i2nD	0.024	0.073	1.760	336	0.010	0.039	6i2nD.pdb.gz	High resolution cryo-EM structure of the helical RNA-bound Hantaan virus nucleocapsid reveals its assembly mechanisms.
20	PDB:3ul5D	0.021	0.187	1.876	84	0.009	0.143	3ul5D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7ESG2	0.0	2593	1286	0.960	1.000	E7ESG2_HUMAN Claspin OS=Homo sapiens OX=9606 GN=CLSPN PE=1 SV=1
2	Q9HAW4	0.0	2718	1339	1.000	1.000	CLSPN_HUMAN Claspin OS=Homo sapiens OX=9606 GN=CLSPN PE=1 SV=3
3	Q8IRB5	1.67e-13	78.2	1465	0.058	0.053	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
4	O17838	1.30e-08	62.0	752	0.034	0.061	O17838_CAEEL Claspin OS=Caenorhabditis elegans OX=6239 GN=clsp-1 PE=1 SV=2
5	Q9P7T4	0.14	39.3	1019	0.018	0.024	MRC1_SCHPO Mediator of replication checkpoint protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrc1 PE=1 SV=1
6	G3MU54	0.76	35.8	235	0.019	0.111	G3MU54_CAEEL Claspin OS=Caenorhabditis elegans OX=6239 GN=clsp-1 PE=1 SV=1
7	F1QJE5	2.2	35.0	537	0.019	0.048	F1QJE5_DANRE Protein phosphatase 1G isoform X1 OS=Danio rerio OX=7955 GN=cb167 PE=1 SV=2
8	Q7ZTW5	2.3	35.0	495	0.019	0.053	Q7ZTW5_DANRE Protein phosphatase 1G OS=Danio rerio OX=7955 GN=cb167 PE=1 SV=1
9	Q9NZM3	4.0	34.3	1697	0.033	0.026	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312995

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388648	0.999	Serine/threonine-protein kinase Chk1
2	9606.ENSP00000261881	0.997	TIMELESS-interacting protein
3	9606.ENSP00000426191	0.997	Cell cycle checkpoint protein RAD17
4	9606.ENSP00000450607	0.995	Protein timeless homolog
5	9606.ENSP00000260810	0.994	DNA topoisomerase 2-binding protein 1
6	9606.ENSP00000311360	0.994	Cell cycle checkpoint control protein RAD9A
7	9606.ENSP00000300093	0.993	Serine/threonine-protein kinase PLK1
8	9606.ENSP00000405726	0.990	Cell division control protein 45 homolog
9	9606.ENSP00000258774	0.987	Checkpoint protein HUS1
10	9606.ENSP00000323099	0.985	ATR-interacting protein
11	9606.ENSP00000343741	0.984	Serine/threonine-protein kinase ATR
12	9606.ENSP00000363017	0.972	Replication protein A 32 kDa subunit
13	9606.ENSP00000254719	0.969	Replication protein A 70 kDa DNA-binding subunit
14	9606.ENSP00000353793	0.969	WD repeat and HMG-box DNA-binding protein 1
15	9606.ENSP00000359206	0.963	F-box/WD repeat-containing protein 1A
16	9606.ENSP00000393139	0.963	Cell division cycle 7-related protein kinase
17	9606.ENSP00000055077	0.961	Replication factor C subunit 2
18	9606.ENSP00000298139	0.957	Werner syndrome ATP-dependent helicase
19	9606.ENSP00000418268	0.954	Protein MCM10 homolog
20	9606.ENSP00000418960	0.951	Breast cancer type 1 susceptibility protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0010997	1.000	anaphase-promoting complex binding
GO:0000217	1.000	DNA secondary structure binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0050794	0.988	regulation of cellular process
GO:0044237	0.988	cellular metabolic process
GO:0050896	0.983	response to stimulus
GO:0006807	0.983	nitrogen compound metabolic process
GO:0043170	0.978	macromolecule metabolic process
GO:0019222	0.955	regulation of metabolic process
GO:0051716	0.950	cellular response to stimulus
GO:1903047	0.940	mitotic cell cycle process
GO:0051171	0.939	regulation of nitrogen compound metabolic process
GO:0006974	0.935	cellular response to DNA damage stimulus
GO:0060255	0.930	regulation of macromolecule metabolic process
GO:0048518	0.929	positive regulation of biological process
GO:0080090	0.928	regulation of primary metabolic process
GO:0031323	0.927	regulation of cellular metabolic process
GO:0036211	0.927	protein modification process
GO:0048522	0.921	positive regulation of cellular process
GO:1901990	0.919	regulation of mitotic cell cycle phase transition
GO:0048523	0.917	negative regulation of cellular process
GO:0010604	0.914	positive regulation of macromolecule metabolic process
GO:0051173	0.913	positive regulation of nitrogen compound metabolic process
GO:0031325	0.912	positive regulation of cellular metabolic process
GO:0000077	0.905	DNA damage checkpoint signaling
GO:0051338	0.876	regulation of transferase activity
GO:0031399	0.872	regulation of protein modification process
GO:0044093	0.869	positive regulation of molecular function
GO:0043085	0.862	positive regulation of catalytic activity
GO:0045930	0.846	negative regulation of mitotic cell cycle
GO:0051247	0.823	positive regulation of protein metabolic process
GO:0007093	0.821	mitotic cell cycle checkpoint signaling
GO:1901991	0.813	negative regulation of mitotic cell cycle phase transition
GO:0044773	0.799	mitotic DNA damage checkpoint signaling
GO:0010389	0.784	regulation of G2/M transition of mitotic cell cycle
GO:0051347	0.752	positive regulation of transferase activity
GO:0042325	0.743	regulation of phosphorylation
GO:0007095	0.729	mitotic G2 DNA damage checkpoint signaling
GO:0001932	0.723	regulation of protein phosphorylation
GO:0000076	0.698	DNA replication checkpoint signaling
GO:0031401	0.680	positive regulation of protein modification process
GO:0045859	0.642	regulation of protein kinase activity
GO:0033674	0.616	positive regulation of kinase activity
GO:0045860	0.592	positive regulation of protein kinase activity
GO:0032147	0.565	activation of protein kinase activity
GO:0006793	0.538	phosphorus metabolic process
GO:0018193	0.450	peptidyl-amino acid modification
GO:0006468	0.373	protein phosphorylation
GO:0018209	0.313	peptidyl-serine modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0005654	1.000	nucleoplasm
GO:0005829	0.574	cytosol
GO:0032991	0.543	protein-containing complex
GO:0043232	0.509	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]