StarFunc result for job id Q9HAW7

User Input

>input (530 residues)
MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLGRSLNCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLF
FSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEG
AQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60656	0.990	0.990	1.971E-95	530	0.932	0.932	O60656.pdb.gz	UD19_HUMAN UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1
2	AFDB:Q64633	0.974	0.972	7.747E-86	531	0.783	0.782	Q64633.pdb.gz	UD17_RAT UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1
3	AFDB:Q64634	0.982	0.982	6.152E-84	530	0.774	0.774	Q64634.pdb.gz	UD18_RAT UDP-glucuronosyltransferase 1A8 OS=Rattus norvegicus OX=10116 GN=Ugt1a8 PE=2 SV=1
4	AFDB:P22310	0.948	0.941	2.041E-73	534	0.674	0.669	P22310.pdb.gz	UD14_HUMAN UDP-glucuronosyltransferase 1A4 OS=Homo sapiens OX=9606 GN=UGT1A4 PE=1 SV=1
5	AFDB:P19224	0.922	0.919	4.388E-73	532	0.691	0.688	P19224.pdb.gz	UD16_HUMAN UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2
6	AFDB:P22309	0.949	0.944	1.630E-72	533	0.660	0.657	P22309.pdb.gz	UD11_HUMAN UDP-glucuronosyltransferase 1A1 OS=Homo sapiens OX=9606 GN=UGT1A1 PE=1 SV=1
7	AFDB:P20720	0.937	0.932	8.408E-72	533	0.626	0.623	P20720.pdb.gz	UD12_RAT UDP-glucuronosyltransferase 1-2 OS=Rattus norvegicus OX=10116 GN=Ugt1a2 PE=2 SV=2
8	AFDB:Q64435	0.938	0.936	1.375E-71	531	0.638	0.637	Q64435.pdb.gz	UD16_MOUSE UDP-glucuronosyltransferase 1-6 OS=Mus musculus OX=10090 GN=Ugt1a6 PE=1 SV=1
9	AFDB:Q64638	0.946	0.945	5.110E-71	531	0.621	0.620	Q64638.pdb.gz	UD15_RAT UDP-glucuronosyltransferase 1A5 OS=Rattus norvegicus OX=10116 GN=Ugt1a5 PE=2 SV=1
10	AFDB:Q63886	0.935	0.926	8.358E-71	535	0.621	0.615	Q63886.pdb.gz	UD11_MOUSE UDP-glucuronosyltransferase 1A1 OS=Mus musculus OX=10090 GN=Ugt1a1 PE=1 SV=2
11	PDB:7va8A	0.539	0.618	7.906E-17	456	0.147	0.171	7va8A.pdb.gz	Directed Evolution of a Plant Glycosyltransferase for Chemo- and Regioselective Glycosylation of Pharmaceutically Significant Flavonoids
12	PDB:1iirA	0.591	0.795	1.896E-16	382	0.121	0.168	1iirA.pdb.gz
13	PDB:6l8xA	0.542	0.628	2.493E-16	450	0.151	0.178	6l8xA.pdb.gz
14	PDB:6llzA	0.561	0.666	2.633E-16	436	0.140	0.170	6llzA.pdb.gz	Crystal Structures of theC-Glycosyltransferase UGT708C1 from Buckwheat Provide Insights into the Mechanism ofC-Glycosylation.
15	PDB:5u6nB	0.539	0.627	3.461E-16	448	0.164	0.194	5u6nB.pdb.gz	Differences in salicylic acid glucose conjugations by UGT74F1 and UGT74F2 from Arabidopsis thaliana.
16	PDB:5tmbA	0.557	0.642	9.260E-16	451	0.158	0.186	5tmbA.pdb.gz	Crystal Structure of Os79 (Os04g0206600) from Oryza sativa: A UDP-glucosyltransferase Involved in the Detoxification of Deoxynivalenol.
17	PDB:1rrvA	0.566	0.724	9.781E-16	401	0.136	0.180	1rrvA.pdb.gz	Crystal Structure of Vancosaminyltransferase Gtfd from the Vancomycin Biosynthetic Pathway: Interactions with Acceptor and Nucleotide Ligands
18	PDB:2vg8A	0.557	0.627	1.286E-15	465	0.147	0.168	2vg8A.pdb.gz	Characterization and Engineering of the Bifunctional N- and O-Glucosyltransferase Involved in Xenobiotic Metabolism in Plants.
19	PDB:6ijaA	0.523	0.650	1.885E-15	415	0.143	0.183	6ijaA.pdb.gz	Crystal structures of rhamnosyltransferase UGT89C1 from Arabidopsis thaliana reveal the molecular basis of sugar donor specificity for UDP-beta-l-rhamnose and rhamnosylation mechanism.
20	PDB:4ambB	0.539	0.737	2.617E-15	373	0.123	0.174	4ambB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	F1QAF6	536	525	0.498	0.503	F1QAF6_DANRE UDP-glucuronosyltransferase OS=Danio rerio OX=7955 GN=ugt1a1 PE=1 SV=1
2	F1R1P2	541	536	0.492	0.487	F1R1P2_DANRE UDP glucuronosyltransferase 1 family polypeptide a3 precursor OS=Danio rerio OX=7955 GN=ugt1ab PE=1 SV=1
3	O60656	1011	530	0.934	0.934	UD19_HUMAN UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1
4	P08430	668	529	0.625	0.626	UD16_RAT UDP-glucuronosyltransferase 1-6 OS=Rattus norvegicus OX=10116 GN=Ugt1a6 PE=1 SV=1
5	P19224	726	532	0.687	0.684	UD16_HUMAN UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2
6	P20720	675	533	0.613	0.610	UD12_RAT UDP-glucuronosyltransferase 1-2 OS=Rattus norvegicus OX=10116 GN=Ugt1a2 PE=2 SV=2
7	P22309	717	533	0.658	0.655	UD11_HUMAN UDP-glucuronosyltransferase 1A1 OS=Homo sapiens OX=9606 GN=UGT1A1 PE=1 SV=1
8	P22310	712	534	0.658	0.654	UD14_HUMAN UDP-glucuronosyltransferase 1A4 OS=Homo sapiens OX=9606 GN=UGT1A4 PE=1 SV=1
9	P35503	721	534	0.662	0.657	UD13_HUMAN UDP-glucuronosyltransferase 1A3 OS=Homo sapiens OX=9606 GN=UGT1A3 PE=1 SV=1
10	Q13460	517	310	0.481	0.823	Q13460_HUMAN UDP-glucuronosyltransferase OS=Homo sapiens OX=9606 GN=UGT1H PE=4 SV=1
11	Q5DSZ8	726	532	0.687	0.684	Q5DSZ8_HUMAN UDP-glucuronosyltransferase OS=Homo sapiens OX=9606 GN=UGT1A6 PE=2 SV=1
12	Q63886	677	535	0.615	0.609	UD11_MOUSE UDP-glucuronosyltransferase 1A1 OS=Mus musculus OX=10090 GN=Ugt1a1 PE=1 SV=2
13	Q64435	687	531	0.632	0.631	UD16_MOUSE UDP-glucuronosyltransferase 1-6 OS=Mus musculus OX=10090 GN=Ugt1a6 PE=1 SV=1
14	Q64550	679	535	0.621	0.615	UD11_RAT UDP-glucuronosyltransferase 1A1 OS=Rattus norvegicus OX=10116 GN=Ugt1a1 PE=1 SV=1
15	Q64633	842	531	0.764	0.763	UD17_RAT UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1
16	Q64634	870	530	0.774	0.774	UD18_RAT UDP-glucuronosyltransferase 1A8 OS=Rattus norvegicus OX=10116 GN=Ugt1a8 PE=2 SV=1
17	Q64637	662	531	0.596	0.595	UD13_RAT UDP-glucuronosyltransferase 1A3 OS=Rattus norvegicus OX=10116 GN=Ugt1a3 PE=2 SV=1
18	Q64638	672	531	0.613	0.612	UD15_RAT UDP-glucuronosyltransferase 1A5 OS=Rattus norvegicus OX=10116 GN=Ugt1a5 PE=2 SV=1
19	Q95KM4	710	533	0.649	0.645	Q95KM4_MACMU UDP-glucuronosyltransferase OS=Macaca mulatta OX=9544 PE=2 SV=1
20	Q9HAW7	1107	530	1.000	1.000	UD17_HUMAN UDP-glucuronosyltransferase 1A7 OS=Homo sapiens OX=9606 GN=UGT1A7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04101 Glyco_tran_28_C	2.2e-05	36.0	Glycosyltransferase family 28 C-terminal domain
2	PF00201 UDPGT	4.9e-237	799.3	UDP-glucoronosyl and UDP-glucosyl transferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362525

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416002	0.889	UDP-galactose translocator
2	9606.ENSP00000369050	0.858	Cytochrome P450 1A1
3	9606.ENSP00000337915	0.841	Cytochrome P450 3A4
4	9606.ENSP00000342007	0.830	Cytochrome P450 1A2
5	9606.ENSP00000222982	0.822	Cytochrome P450 3A5
6	9606.ENSP00000346768	0.815	UDP-glucuronosyltransferase 1-9
7	9606.ENSP00000343838	0.805	UDP-glucuronosyltransferase 1-10
8	9606.ENSP00000360317	0.804	Cytochrome P450 2C8
9	9606.ENSP00000260682	0.802	Cytochrome P450 2C9
10	9606.ENSP00000324648	0.800	Cytochrome P450 2B6
11	9606.ENSP00000332679	0.800	Cytochrome P450 2A13
12	9606.ENSP00000440689	0.800	Cytochrome P450 2E1
13	9606.ENSP00000353820	0.799	Cytochrome P450 2D6
14	9606.ENSP00000354511	0.793	Catechol O-methyltransferase
15	9606.ENSP00000478561	0.791	Cytochrome P450 1B1
16	9606.ENSP00000301141	0.784	Cytochrome P450 2A6
17	9606.ENSP00000480571	0.779	Cytochrome P450 3A7
18	9606.ENSP00000319501	0.764	UDP-glucose 6-dehydrogenase
19	9606.ENSP00000317842	0.758	Cocaine esterase
20	9606.ENSP00000360958	0.753	Cytochrome P450 4A22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015020	1.000	glucuronosyltransferase activity
GO:0042803	0.999	protein homodimerization activity
GO:0019899	0.997	enzyme binding
GO:0046982	0.997	protein heterodimerization activity
GO:0001972	0.997	retinoic acid binding
GO:0098772	0.805	molecular function regulator activity
GO:0030234	0.802	enzyme regulator activity
GO:0140678	0.657	molecular function inhibitor activity
GO:0004857	0.547	enzyme inhibitor activity
GO:0097159	0.305	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0044238	0.984	primary metabolic process
GO:0009812	0.981	flavonoid metabolic process
GO:0006805	0.979	xenobiotic metabolic process
GO:0044281	0.978	small molecule metabolic process
GO:0032787	0.956	monocarboxylic acid metabolic process
GO:0001523	0.954	retinoid metabolic process
GO:0042573	0.932	retinoic acid metabolic process
GO:1901360	0.929	organic cyclic compound metabolic process
GO:0042440	0.925	pigment metabolic process
GO:0062014	0.731	negative regulation of small molecule metabolic process
GO:0045833	0.731	negative regulation of lipid metabolic process
GO:0010565	0.721	regulation of cellular ketone metabolic process
GO:0010677	0.649	negative regulation of cellular carbohydrate metabolic process
GO:0045922	0.539	negative regulation of fatty acid metabolic process
GO:0008202	0.537	steroid metabolic process
GO:0008210	0.375	estrogen metabolic process
GO:0006631	0.370	fatty acid metabolic process
GO:0009056	0.312	catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	0.999	endoplasmic reticulum
GO:0005789	0.911	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21032	1.000	glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
EC:2.4.1.17	1.000	glucuronosyltransferase.

[back to server]