StarFunc result for job id Q9HAW9

User Input

>input (530 residues)
MARTGWTSPIPLCVSLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMP
EVSWQLGKSLNCTVKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNGFFNLF
FSHCRSLFNDRKLVEYLKESSFDAVFLDPFDACGLIVAKYFSLPSVVFARGIACHYLEEG
AQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLFCQYFSKNALEIASEILQTPVT
AYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIV
VFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH
PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDL
ENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW
YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O60656	0.991	0.991	2.122E-96	530	0.949	0.949	O60656.pdb.gz	UD19_HUMAN UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1
2	AFDB:Q64634	0.986	0.986	2.928E-85	530	0.781	0.781	Q64634.pdb.gz	UD18_RAT UDP-glucuronosyltransferase 1A8 OS=Rattus norvegicus OX=10116 GN=Ugt1a8 PE=2 SV=1
3	AFDB:Q64633	0.984	0.982	6.158E-84	531	0.777	0.776	Q64633.pdb.gz	UD17_RAT UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1
4	AFDB:P22309	0.946	0.940	3.426E-73	533	0.664	0.660	P22309.pdb.gz	UD11_HUMAN UDP-glucuronosyltransferase 1A1 OS=Homo sapiens OX=9606 GN=UGT1A1 PE=1 SV=1
5	AFDB:P19224	0.941	0.938	4.021E-73	532	0.685	0.682	P19224.pdb.gz	UD16_HUMAN UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2
6	AFDB:Q63886	0.945	0.937	4.454E-72	535	0.632	0.626	Q63886.pdb.gz	UD11_MOUSE UDP-glucuronosyltransferase 1A1 OS=Mus musculus OX=10090 GN=Ugt1a1 PE=1 SV=2
7	AFDB:P22310	0.946	0.939	8.017E-72	534	0.679	0.674	P22310.pdb.gz	UD14_HUMAN UDP-glucuronosyltransferase 1A4 OS=Homo sapiens OX=9606 GN=UGT1A4 PE=1 SV=1
8	AFDB:P20720	0.942	0.936	2.740E-71	533	0.632	0.629	P20720.pdb.gz	UD12_RAT UDP-glucuronosyltransferase 1-2 OS=Rattus norvegicus OX=10116 GN=Ugt1a2 PE=2 SV=2
9	AFDB:Q64638	0.946	0.945	7.979E-71	531	0.621	0.620	Q64638.pdb.gz	UD15_RAT UDP-glucuronosyltransferase 1A5 OS=Rattus norvegicus OX=10116 GN=Ugt1a5 PE=2 SV=1
10	AFDB:Q64637	0.940	0.939	1.515E-70	531	0.608	0.606	Q64637.pdb.gz	UD13_RAT UDP-glucuronosyltransferase 1A3 OS=Rattus norvegicus OX=10116 GN=Ugt1a3 PE=2 SV=1
11	PDB:7va8A	0.534	0.612	3.503E-16	456	0.142	0.164	7va8A.pdb.gz	Directed Evolution of a Plant Glycosyltransferase for Chemo- and Regioselective Glycosylation of Pharmaceutically Significant Flavonoids
12	PDB:5u6nB	0.490	0.571	4.338E-16	448	0.158	0.188	5u6nB.pdb.gz	Differences in salicylic acid glucose conjugations by UGT74F1 and UGT74F2 from Arabidopsis thaliana.
13	PDB:6l8xA	0.529	0.613	4.338E-16	450	0.142	0.167	6l8xA.pdb.gz
14	PDB:6lf6A	0.512	0.584	5.978E-16	457	0.130	0.151	6lf6A.pdb.gz	Dissection of the general two-step di- C -glycosylation pathway for the biosynthesis of (iso)schaftosides in higher plants.
15	PDB:6llzA	0.564	0.671	5.978E-16	436	0.136	0.165	6llzA.pdb.gz	Crystal Structures of theC-Glycosyltransferase UGT708C1 from Buckwheat Provide Insights into the Mechanism ofC-Glycosylation.
16	PDB:5tmbA	0.528	0.612	1.836E-15	451	0.162	0.191	5tmbA.pdb.gz	Crystal Structure of Os79 (Os04g0206600) from Oryza sativa: A UDP-glucosyltransferase Involved in the Detoxification of Deoxynivalenol.
17	PDB:2c1zA	0.513	0.607	3.880E-15	439	0.147	0.178	2c1zA.pdb.gz	Structure of a Flavonoid Glucosyltransferase Reveals the Basis for Plant Natural Product Modification.
18	PDB:3d0rB	0.518	0.689	5.640E-15	381	0.128	0.178	3d0rB.pdb.gz
19	PDB:1iirA	0.567	0.761	8.199E-15	382	0.125	0.173	1iirA.pdb.gz
20	PDB:2vg8A	0.573	0.645	1.071E-14	465	0.149	0.170	2vg8A.pdb.gz	Characterization and Engineering of the Bifunctional N- and O-Glucosyltransferase Involved in Xenobiotic Metabolism in Plants.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	F1QAF6	549	525	0.500	0.505	F1QAF6_DANRE UDP-glucuronosyltransferase OS=Danio rerio OX=7955 GN=ugt1a1 PE=1 SV=1
2	F1QRI1	526	520	0.466	0.475	F1QRI1_DANRE UDP-glucuronosyltransferase OS=Danio rerio OX=7955 GN=ugt1a6 PE=1 SV=1
3	F1R1P2	545	536	0.494	0.489	F1R1P2_DANRE UDP glucuronosyltransferase 1 family polypeptide a3 precursor OS=Danio rerio OX=7955 GN=ugt1ab PE=1 SV=1
4	O60656	1030	530	0.949	0.949	UD19_HUMAN UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1
5	P08430	672	529	0.628	0.629	UD16_RAT UDP-glucuronosyltransferase 1-6 OS=Rattus norvegicus OX=10116 GN=Ugt1a6 PE=1 SV=1
6	P19224	732	532	0.692	0.690	UD16_HUMAN UDP-glucuronosyltransferase 1-6 OS=Homo sapiens OX=9606 GN=UGT1A6 PE=1 SV=2
7	P20720	693	533	0.623	0.619	UD12_RAT UDP-glucuronosyltransferase 1-2 OS=Rattus norvegicus OX=10116 GN=Ugt1a2 PE=2 SV=2
8	P22309	724	533	0.664	0.660	UD11_HUMAN UDP-glucuronosyltransferase 1A1 OS=Homo sapiens OX=9606 GN=UGT1A1 PE=1 SV=1
9	P22310	727	534	0.662	0.657	UD14_HUMAN UDP-glucuronosyltransferase 1A4 OS=Homo sapiens OX=9606 GN=UGT1A4 PE=1 SV=1
10	P35503	737	534	0.672	0.667	UD13_HUMAN UDP-glucuronosyltransferase 1A3 OS=Homo sapiens OX=9606 GN=UGT1A3 PE=1 SV=1
11	Q13460	595	310	0.534	0.913	Q13460_HUMAN UDP-glucuronosyltransferase OS=Homo sapiens OX=9606 GN=UGT1H PE=4 SV=1
12	Q561S7	525	520	0.470	0.479	Q561S7_DANRE UDP-glucuronosyltransferase OS=Danio rerio OX=7955 GN=ugt1a4 PE=1 SV=1
13	Q5DSZ8	732	532	0.692	0.690	Q5DSZ8_HUMAN UDP-glucuronosyltransferase OS=Homo sapiens OX=9606 GN=UGT1A6 PE=2 SV=1
14	Q63886	688	535	0.630	0.624	UD11_MOUSE UDP-glucuronosyltransferase 1A1 OS=Mus musculus OX=10090 GN=Ugt1a1 PE=1 SV=2
15	Q64435	689	531	0.634	0.633	UD16_MOUSE UDP-glucuronosyltransferase 1-6 OS=Mus musculus OX=10090 GN=Ugt1a6 PE=1 SV=1
16	Q64550	689	535	0.630	0.624	UD11_RAT UDP-glucuronosyltransferase 1A1 OS=Rattus norvegicus OX=10116 GN=Ugt1a1 PE=1 SV=1
17	Q64633	840	531	0.766	0.765	UD17_RAT UDP-glucuronosyltransferase 1A7 OS=Rattus norvegicus OX=10116 GN=Ugt1a7 PE=2 SV=1
18	Q64634	876	530	0.781	0.781	UD18_RAT UDP-glucuronosyltransferase 1A8 OS=Rattus norvegicus OX=10116 GN=Ugt1a8 PE=2 SV=1
19	Q64637	665	531	0.598	0.597	UD13_RAT UDP-glucuronosyltransferase 1A3 OS=Rattus norvegicus OX=10116 GN=Ugt1a3 PE=2 SV=1
20	Q64638	681	531	0.617	0.616	UD15_RAT UDP-glucuronosyltransferase 1A5 OS=Rattus norvegicus OX=10116 GN=Ugt1a5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04101 Glyco_tran_28_C	2e-05	36.1	Glycosyltransferase family 28 C-terminal domain
2	PF00201 UDPGT	1e-241	814.7	UDP-glucoronosyl and UDP-glucosyl transferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362549

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337915	0.952	Cytochrome P450 3A4
2	9606.ENSP00000416002	0.937	UDP-galactose translocator
3	9606.ENSP00000260682	0.921	Cytochrome P450 2C9
4	9606.ENSP00000342007	0.920	Cytochrome P450 1A2
5	9606.ENSP00000222982	0.919	Cytochrome P450 3A5
6	9606.ENSP00000369050	0.917	Cytochrome P450 1A1
7	9606.ENSP00000353820	0.914	Cytochrome P450 2D6
8	9606.ENSP00000324648	0.908	Cytochrome P450 2B6
9	9606.ENSP00000360317	0.897	Cytochrome P450 2C8
10	9606.ENSP00000440689	0.886	Cytochrome P450 2E1
11	9606.ENSP00000478561	0.877	Cytochrome P450 1B1
12	9606.ENSP00000301141	0.869	Cytochrome P450 2A6
13	9606.ENSP00000480571	0.868	Cytochrome P450 3A7
14	9606.ENSP00000354511	0.861	Catechol O-methyltransferase
15	9606.ENSP00000226444	0.854	Estrogen sulfotransferase
16	9606.ENSP00000319501	0.848	UDP-glucose 6-dehydrogenase
17	9606.ENSP00000317842	0.843	Cocaine esterase
18	9606.ENSP00000285979	0.840	Cytochrome P450 2C18
19	9606.ENSP00000302728	0.818	Beta-glucuronidase
20	9606.ENSP00000385757	0.816	Biliverdin reductase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	1.000	protein heterodimerization activity
GO:0015020	1.000	glucuronosyltransferase activity
GO:0042803	0.999	protein homodimerization activity
GO:0033293	0.999	monocarboxylic acid binding
GO:0019899	0.997	enzyme binding
GO:0005501	0.995	retinoid binding
GO:0001972	0.994	retinoic acid binding
GO:0030234	0.991	enzyme regulator activity
GO:0140678	0.727	molecular function inhibitor activity
GO:0004857	0.702	enzyme inhibitor activity
GO:0097159	0.304	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044238	0.982	primary metabolic process
GO:0009812	0.980	flavonoid metabolic process
GO:0006082	0.978	organic acid metabolic process
GO:0006805	0.976	xenobiotic metabolic process
GO:0001523	0.952	retinoid metabolic process
GO:0019752	0.937	carboxylic acid metabolic process
GO:0032787	0.932	monocarboxylic acid metabolic process
GO:0042445	0.898	hormone metabolic process
GO:0010677	0.848	negative regulation of cellular carbohydrate metabolic process
GO:0042573	0.801	retinoic acid metabolic process
GO:1901360	0.770	organic cyclic compound metabolic process
GO:0010565	0.721	regulation of cellular ketone metabolic process
GO:0019216	0.710	regulation of lipid metabolic process
GO:0062014	0.694	negative regulation of small molecule metabolic process
GO:0042440	0.675	pigment metabolic process
GO:0045833	0.661	negative regulation of lipid metabolic process
GO:0045922	0.528	negative regulation of fatty acid metabolic process
GO:0008202	0.461	steroid metabolic process
GO:0006807	0.368	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.998	membrane
GO:0031090	0.882	organelle membrane
GO:0005789	0.827	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21032	1.000	glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
EC:2.4.1.17	1.000	glucuronosyltransferase.

[back to server]