StarFunc result for job id Q9HAY2

User Input

>input (307 residues)
MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGAR
ALAAKALARRRAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIAR
AAEHLRYVFGFELKQFDRKHHTYILINKLKPLEEEEEEDLGGDGPRLGLLMMILGLIYMR
GNSAREAQVWEMLRRLGVQPSKYHFLFGYPKRLIMEDFVQQRYLSYRRVPHTNPPEYEFS
WGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASA
RAGIHLW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAY2	1.000	1.000	1.069E-52	307	1.000	1.000	Q9HAY2.pdb.gz	MAGF1_HUMAN Melanoma-associated antigen F1 OS=Homo sapiens OX=9606 GN=MAGEF1 PE=1 SV=2
2	AFDB:Q9CPR8	0.661	0.725	4.056E-29	279	0.456	0.502	Q9CPR8.pdb.gz	NSE3_MOUSE Non-structural maintenance of chromosomes element 3 homolog OS=Mus musculus OX=10090 GN=Nsmce3 PE=1 SV=1
3	AFDB:Q96MG7	0.636	0.642	1.724E-28	304	0.476	0.480	Q96MG7.pdb.gz	NSE3_HUMAN Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1
4	AFDB:Q5H907	0.677	0.406	3.801E-25	521	0.414	0.244	Q5H907.pdb.gz	Q5H907_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=1
5	AFDB:Q9HCI5	0.666	0.218	4.027E-25	957	0.401	0.129	Q9HCI5.pdb.gz	MAGE1_HUMAN Melanoma-associated antigen E1 OS=Homo sapiens OX=9606 GN=MAGEE1 PE=1 SV=2
6	AFDB:Q001T8	0.644	0.796	5.379E-25	246	0.349	0.435	Q001T8.pdb.gz	Q001T8_CHICK MAGE protein OS=Gallus gallus OX=9031 GN=mage PE=4 SV=1
7	AFDB:E9Q1Q4	0.653	0.676	1.616E-24	296	0.384	0.399	E9Q1Q4.pdb.gz	E9Q1Q4_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
8	AFDB:Q6PCZ4	0.682	0.232	3.633E-24	918	0.381	0.127	Q6PCZ4.pdb.gz	MAGE1_MOUSE Melanoma-associated antigen E1 OS=Mus musculus OX=10090 GN=Magee1 PE=1 SV=1
9	AFDB:Q6DIC6	0.678	0.104	8.170E-24	2087	0.397	0.058	Q6DIC6.pdb.gz	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
10	AFDB:A0A024R9Y7	0.675	0.350	1.030E-23	606	0.430	0.218	A0A024R9Y7.pdb.gz
11	PDB:7qcdE	0.534	0.617	1.158E-7	261	0.124	0.146	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
12	PDB:7tveF	0.495	0.557	1.863E-6	270	0.111	0.126	7tveF.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
13	PDB:3cuqA	0.215	0.276	2.077E-2	219	0.081	0.114	3cuqA.pdb.gz
14	PDB:7a6hO	0.157	0.099	3.925E-2	512	0.104	0.062	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
15	PDB:3euhC	0.250	0.331	4.407E-2	206	0.094	0.141	3euhC.pdb.gz
16	PDB:1u5tA	0.218	0.288	4.948E-2	213	0.062	0.089	1u5tA.pdb.gz
17	PDB:7d58O	0.190	0.126	9.353E-2	490	0.117	0.073	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
18	PDB:7ctfA	0.192	0.463	1.403E-1	102	0.039	0.118	7ctfA.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
19	PDB:6hixBN	0.204	0.279	1.486E-1	214	0.042	0.061	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
20	PDB:6yxyBi	0.202	0.296	1.668E-1	192	0.081	0.130	6yxyBi.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HAY2	0.0	622	307	1.000	1.000	MAGF1_HUMAN Melanoma-associated antigen F1 OS=Homo sapiens OX=9606 GN=MAGEF1 PE=1 SV=2
2	Q96MG7	2.59e-96	288	304	0.502	0.507	NSE3_HUMAN Non-structural maintenance of chromosomes element 3 homolog OS=Homo sapiens OX=9606 GN=NSMCE3 PE=1 SV=1
3	Q9CPR8	1.07e-95	286	279	0.479	0.527	NSE3_MOUSE Non-structural maintenance of chromosomes element 3 homolog OS=Mus musculus OX=10090 GN=Nsmce3 PE=1 SV=1
4	Q001T8	1.37e-65	207	246	0.332	0.415	Q001T8_CHICK MAGE protein OS=Gallus gallus OX=9031 GN=mage PE=4 SV=1
5	Q5H907	1.42e-65	216	521	0.322	0.190	Q5H907_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=1
6	Q9UNF1	3.61e-65	217	606	0.322	0.163	MAGD2_HUMAN Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
7	Q5H909	4.51e-65	216	588	0.322	0.168	Q5H909_HUMAN MAGE family member D2 OS=Homo sapiens OX=9606 GN=MAGED2 PE=1 SV=2
8	Q9HCI5	1.18e-64	221	957	0.362	0.116	MAGE1_HUMAN Melanoma-associated antigen E1 OS=Homo sapiens OX=9606 GN=MAGEE1 PE=1 SV=2
9	Q6PCZ4	2.90e-63	216	918	0.349	0.117	MAGE1_MOUSE Melanoma-associated antigen E1 OS=Mus musculus OX=10090 GN=Magee1 PE=1 SV=1
10	E9Q098	8.02e-61	209	838	0.322	0.118	E9Q098_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
11	Q99PH7	1.05e-60	209	831	0.322	0.119	Q99PH7_MOUSE Magphinin-beta 2 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
12	E9Q1Q4	1.16e-60	197	296	0.322	0.334	E9Q1Q4_MOUSE Trophinin OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
13	Q8BQR7	1.70e-60	197	327	0.332	0.312	MAGBI_MOUSE Melanoma-associated antigen B18 OS=Mus musculus OX=10090 GN=Mageb18 PE=1 SV=1
14	Q99PM5	2.28e-60	208	906	0.322	0.109	Q99PM5_MOUSE Magphinin-alpha OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
15	Q99NC2	3.80e-60	207	804	0.322	0.123	Q99NC2_MOUSE MAGE-necdin/trophinin complex (Magphinin) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
16	O15481	2.48e-59	195	346	0.306	0.272	MAGB4_HUMAN Melanoma-associated antigen B4 OS=Homo sapiens OX=9606 GN=MAGEB4 PE=1 SV=1
17	Q80TJ5	1.63e-58	204	1736	0.326	0.058	Q80TJ5_MOUSE MKIAA1114 protein (Fragment) OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
18	Q99PB3	1.66e-58	204	1987	0.326	0.050	Q99PB3_MOUSE Mage-d3 OS=Mus musculus OX=10090 GN=Tro PE=2 SV=1
19	Q6DIC6	1.67e-58	204	2087	0.326	0.048	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
20	G5E9N2	3.80e-58	199	681	0.319	0.144	G5E9N2_HUMAN Trophinin OS=Homo sapiens OX=9606 GN=TRO PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11297 DUF3098	6.5e+02	11.3	Protein of unknown function (DUF3098)
2	PF01454 MAGE	1.4e-22	92.0	MAGE homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315064

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355077	0.845	Non-structural maintenance of chromosomes element 1 homolog
2	9606.ENSP00000358019	0.799	Non-structural maintenance of chromosomes element 4 homolog A
3	9606.ENSP00000359310	0.767	Putative chondrosarcoma-associated gene 1 protein
4	9606.ENSP00000311196	0.739	Neuronal PAS domain-containing protein 4
5	9606.ENSP00000354957	0.699	Structural maintenance of chromosomes protein 5
6	9606.ENSP00000435619	0.673	EP300-interacting inhibitor of differentiation 3
7	9606.ENSP00000287437	0.656	E3 SUMO-protein ligase NSE2
8	9606.ENSP00000431162	0.654	EP300-interacting inhibitor of differentiation 1
9	9606.ENSP00000320081	0.625	Deleted in autism protein 1
10	9606.ENSP00000229179	0.623	Nuclear pore complex protein Nup107
11	9606.ENSP00000426978	0.622	Nuclear RNA export factor 5
12	9606.ENSP00000338796	0.603	Synovial sarcoma, X breakpoint 2
13	9606.ENSP00000477922	0.603	Synovial sarcoma, X breakpoint 2B
14	9606.ENSP00000436679	0.593	Nuclear RNA export factor 1
15	9606.ENSP00000351407	0.589	Aryl hydrocarbon receptor nuclear translocator
16	9606.ENSP00000484645	0.569	Nuclear RNA export factor 2B
17	9606.ENSP00000485586	0.569	Nuclear RNA export factor 2
18	9606.ENSP00000366404	0.562	Zinc finger protein RFP
19	9606.ENSP00000404092	0.557	Structural maintenance of chromosomes protein 6
20	9606.ENSP00000266736	0.545	Probable imidazolonepropionase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0080090	0.987	regulation of primary metabolic process
GO:0051171	0.987	regulation of nitrogen compound metabolic process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0071704	0.977	organic substance metabolic process
GO:0048518	0.965	positive regulation of biological process
GO:0019219	0.925	regulation of nucleobase-containing compound metabolic process
GO:0044238	0.918	primary metabolic process
GO:0043170	0.901	macromolecule metabolic process
GO:2001020	0.887	regulation of response to DNA damage stimulus
GO:0009893	0.880	positive regulation of metabolic process
GO:0048519	0.879	negative regulation of biological process
GO:0006807	0.870	nitrogen compound metabolic process
GO:0048523	0.862	negative regulation of cellular process
GO:0009987	0.858	cellular process
GO:0009892	0.847	negative regulation of metabolic process
GO:0010604	0.817	positive regulation of macromolecule metabolic process
GO:0048522	0.782	positive regulation of cellular process
GO:0010605	0.754	negative regulation of macromolecule metabolic process
GO:0031324	0.732	negative regulation of cellular metabolic process
GO:0051172	0.726	negative regulation of nitrogen compound metabolic process
GO:0051173	0.725	positive regulation of nitrogen compound metabolic process
GO:0045934	0.720	negative regulation of nucleobase-containing compound metabolic process
GO:0006282	0.652	regulation of DNA repair
GO:0031325	0.611	positive regulation of cellular metabolic process
GO:0000018	0.582	regulation of DNA recombination
GO:2000779	0.582	regulation of double-strand break repair
GO:0010569	0.570	regulation of double-strand break repair via homologous recombination
GO:0051247	0.550	positive regulation of protein metabolic process
GO:0009894	0.507	regulation of catabolic process
GO:0051053	0.423	negative regulation of DNA metabolic process
GO:0010468	0.380	regulation of gene expression
GO:0045910	0.357	negative regulation of DNA recombination
GO:0010467	0.318	gene expression
GO:0044237	0.307	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0043232	0.932	intracellular non-membrane-bounded organelle
GO:0032991	0.903	protein-containing complex
GO:0000793	0.884	condensed chromosome
GO:0030915	0.605	Smc5-Smc6 complex
GO:0005829	0.537	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]