StarFunc result for job id Q9HAY6

User Input

>input (547 residues)
MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFG
VTENYVIFLEQPFRLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFY
TDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFA
VPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRY
VFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVS
TDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASD
CHGAPLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HAY6	1.000	1.000	0.000	547	1.000	1.000	Q9HAY6.pdb.gz	BCDO1_HUMAN Beta,beta-carotene 15,15'-dioxygenase OS=Homo sapiens OX=9606 GN=BCO1 PE=1 SV=1
2	AFDB:Q91XT5	0.942	0.911	3.705E-97	566	0.830	0.802	Q91XT5.pdb.gz	BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus OX=10116 GN=Bco1 PE=2 SV=1
3	AFDB:Q9I993	0.942	0.979	1.811E-87	526	0.671	0.698	Q9I993.pdb.gz	BCDO1_CHICK Beta,beta-carotene 15,15'-dioxygenase OS=Gallus gallus OX=9031 GN=BCO1 PE=1 SV=1
4	AFDB:A0A0R4IH96	0.914	0.885	6.088E-77	565	0.563	0.545	A0A0R4IH96.pdb.gz
5	AFDB:Q99NF1	0.896	0.921	9.517E-63	532	0.391	0.402	Q99NF1.pdb.gz	BCDO2_MOUSE Carotenoid-cleaving dioxygenase, mitochondrial OS=Mus musculus OX=10090 GN=Bco2 PE=1 SV=1
6	AFDB:Q9BYV7	0.895	0.847	1.371E-62	579	0.375	0.354	Q9BYV7.pdb.gz	BCDO2_HUMAN Carotenoid-cleaving dioxygenase, mitochondrial OS=Homo sapiens OX=9606 GN=BCO2 PE=1 SV=5
7	AFDB:Q6QT07	0.890	0.900	2.191E-62	541	0.397	0.401	Q6QT07.pdb.gz	BCDO2_MUSPF Carotenoid-cleaving dioxygenase, mitochondrial OS=Mustela putorius furo OX=9669 GN=BCO2 PE=1 SV=1
8	AFDB:A2BGP6	0.873	0.870	3.657E-61	549	0.419	0.417	A2BGP6.pdb.gz
9	AFDB:O70276	0.888	0.911	3.409E-59	533	0.377	0.386	O70276.pdb.gz	RPE65_RAT Retinoid isomerohydrolase OS=Rattus norvegicus OX=10116 GN=Rpe65 PE=2 SV=4
10	AFDB:Q9YGX2	0.891	0.913	7.850E-59	533	0.377	0.386	Q9YGX2.pdb.gz	RPE65_CHICK Retinoid isomerohydrolase OS=Gallus gallus OX=9031 GN=RPE65 PE=1 SV=1
11	PDB:7k88A	0.849	0.924	6.245E-56	502	0.353	0.384	7k88A.pdb.gz	Rational Alteration of Pharmacokinetics of Chiral Fluorinated and Deuterated Derivatives of Emixustat for Retinal Therapy.
12	PDB:4f30A	0.879	0.922	1.052E-55	521	0.355	0.372	4f30A.pdb.gz	Structure of RPE65 isomerase in a lipidic matrix reveals roles for phospholipids and iron in catalysis.
13	PDB:6ojtB	0.673	0.759	1.568E-30	481	0.185	0.210	6ojtB.pdb.gz	Identification of functionally important residues and structural features in a bacterial lignostilbene dioxygenase.
14	PDB:7d5sBE	0.170	0.125	1.341E-7	865	0.128	0.081	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
15	PDB:7ajuUL	0.149	0.111	1.198E-6	779	0.084	0.059	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7ayqA	0.299	0.221	1.262E-6	808	0.080	0.054	7ayqA.pdb.gz	Chemoproteomics-Enabled Identification of 4-Oxo-beta-Lactams as Inhibitors of Dipeptidyl Peptidases 8 and 9.
17	PDB:4noxA	0.321	0.368	2.485E-6	460	0.086	0.102	4noxA.pdb.gz
18	PDB:6nd4Q	0.129	0.090	5.431E-6	862	0.099	0.063	6nd4Q.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
19	PDB:7mq8LR	0.148	0.110	6.027E-6	773	0.102	0.072	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6lqsB1	0.193	0.144	7.047E-6	806	0.084	0.057	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7ZTS0	0.0	672	516	0.565	0.599	Q7ZTS0_DANRE Beta-carotene 15,15'-monooxygenase 1 OS=Danio rerio OX=7955 GN=bcmo1 PE=1 SV=1
2	Q91XT5	0.0	994	566	0.843	0.814	BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus OX=10116 GN=Bco1 PE=2 SV=1
3	Q9HAY6	0.0	1151	547	1.000	1.000	BCDO1_HUMAN Beta,beta-carotene 15,15'-dioxygenase OS=Homo sapiens OX=9606 GN=BCO1 PE=1 SV=1
4	Q9I993	0.0	828	526	0.673	0.700	BCDO1_CHICK Beta,beta-carotene 15,15'-dioxygenase OS=Gallus gallus OX=9031 GN=BCO1 PE=1 SV=1
5	Q9JJS6	0.0	1001	566	0.852	0.823	BCDO1_MOUSE Beta,beta-carotene 15,15'-dioxygenase OS=Mus musculus OX=10090 GN=Bco1 PE=1 SV=2
6	Q90WH3	3.56e-150	444	549	0.417	0.415	Q90WH3_DANRE Beta-carotene 15, 15-dioxygenase 2 OS=Danio rerio OX=7955 GN=b-diox-II PE=2 SV=1
7	Q6QT07	3.52e-149	441	541	0.411	0.416	BCDO2_MUSPF Carotenoid-cleaving dioxygenase, mitochondrial OS=Mustela putorius furo OX=9669 GN=BCO2 PE=1 SV=1
8	Q99NF1	1.29e-145	431	532	0.400	0.412	BCDO2_MOUSE Carotenoid-cleaving dioxygenase, mitochondrial OS=Mus musculus OX=10090 GN=Bco2 PE=1 SV=1
9	Q9BYV7	4.33e-141	421	579	0.395	0.373	BCDO2_HUMAN Carotenoid-cleaving dioxygenase, mitochondrial OS=Homo sapiens OX=9606 GN=BCO2 PE=1 SV=5
10	A9C3R8	4.46e-140	417	532	0.391	0.402	RP65C_DANRE Retinal Mueller cells isomerohydrolase OS=Danio rerio OX=7955 GN=rpe65c PE=1 SV=1
11	Q16518	3.16e-136	407	533	0.377	0.386	RPE65_HUMAN Retinoid isomerohydrolase OS=Homo sapiens OX=9606 GN=RPE65 PE=1 SV=3
12	Q9TVB8	3.30e-136	407	533	0.378	0.388	RPE65_CANLF Retinoid isomerohydrolase OS=Canis lupus familiaris OX=9615 GN=RPE65 PE=1 SV=3
13	O70276	6.12e-135	404	533	0.380	0.390	RPE65_RAT Retinoid isomerohydrolase OS=Rattus norvegicus OX=10116 GN=Rpe65 PE=2 SV=4
14	Q28175	1.22e-134	403	533	0.375	0.385	RPE65_BOVIN Retinoid isomerohydrolase OS=Bos taurus OX=9913 GN=RPE65 PE=1 SV=4
15	Q91ZQ5	1.97e-134	403	533	0.377	0.386	RPE65_MOUSE Retinoid isomerohydrolase OS=Mus musculus OX=10090 GN=Rpe65 PE=1 SV=4
16	Q9YGX2	1.73e-133	400	533	0.375	0.385	RPE65_CHICK Retinoid isomerohydrolase OS=Gallus gallus OX=9031 GN=RPE65 PE=1 SV=1
17	Q9VFS2	5.36e-84	275	620	0.336	0.297	NINAB_DROME Carotenoid isomerooxygenase OS=Drosophila melanogaster OX=7227 GN=ninaB PE=1 SV=1
18	Q8LIY8	1.40e-50	184	569	0.261	0.251	CCD8B_ORYSJ Carotenoid cleavage dioxygenase 8 homolog B, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CCD8B PE=1 SV=1
19	Q8VY26	6.21e-49	180	570	0.274	0.263	CCD8_ARATH Carotenoid cleavage dioxygenase 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CCD8 PE=1 SV=1
20	P9WPR5	1.14e-14	79.0	501	0.218	0.238	CCO_MYCTU Carotenoid cleavage oxygenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0654 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02424 ApbE	6.3e+02	11.3	ApbE family
2	PF13340 DUF4096	3e+02	13.0	Putative transposase of IS4/5 family (DUF4096)
3	PF03055 RPE65	6.2e-120	413.1	Retinal pigment epithelial membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258168

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240285	0.956	Retinol dehydrogenase 10
2	9606.ENSP00000370750	0.945	Retinol dehydrogenase 11
3	9606.ENSP00000249750	0.944	Retinal dehydrogenase 2
4	9606.ENSP00000326219	0.942	Dehydrogenase/reductase SDR family member 4
5	9606.ENSP00000297785	0.941	Retinal dehydrogenase 1
6	9606.ENSP00000332256	0.940	Aldehyde dehydrogenase family 1 member A3
7	9606.ENSP00000449079	0.938	Retinol dehydrogenase 12
8	9606.ENSP00000480439	0.933	Short-chain dehydrogenase/reductase 3
9	9606.ENSP00000466058	0.932	Retinol dehydrogenase 8
10	9606.ENSP00000311492	0.929	Intestine-specific homeobox
11	9606.ENSP00000389241	0.928	Dehydrogenase/reductase SDR family member 9
12	9606.ENSP00000381206	0.926	Retinol dehydrogenase 16
13	9606.ENSP00000307607	0.924	Epidermal retinol dehydrogenase 2
14	9606.ENSP00000363832	0.918	Aldehyde oxidase
15	9606.ENSP00000420269	0.918	Alcohol dehydrogenase class 4 mu/sigma chain
16	9606.ENSP00000451406	0.913	17-beta-hydroxysteroid dehydrogenase type 6
17	9606.ENSP00000426083	0.912	Alcohol dehydrogenase 1C, gamma polypeptide
18	9606.ENSP00000209668	0.909	Alcohol dehydrogenase 1A, alpha polypeptide
19	9606.ENSP00000306606	0.908	Alcohol dehydrogenase 1B, beta polypeptide
20	9606.ENSP00000265512	0.903	Alcohol dehydrogenase 4, pi polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016702	0.999	oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0003834	0.728	beta-carotene 15,15'-dioxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0001523	0.992	retinoid metabolic process
GO:0006081	0.959	cellular aldehyde metabolic process
GO:0120254	0.956	olefinic compound metabolic process
GO:0042574	0.832	retinal metabolic process
GO:0016042	0.640	lipid catabolic process
GO:0044242	0.598	cellular lipid catabolic process
GO:0042214	0.594	terpene metabolic process
GO:0008300	0.588	isoprenoid catabolic process
GO:0120253	0.409	hydrocarbon catabolic process
GO:0065007	0.354	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.992	cytosol
GO:0043226	0.755	organelle
GO:0043227	0.706	membrane-bounded organelle
GO:0043229	0.680	intracellular organelle
GO:0043231	0.610	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.13.11.-	0.999	With incorporation of two atoms of oxygen.
RHEA:32887	0.728	all-trans-beta-carotene + O2 = 2 all-trans-retinal
EC:1.13.11.63	0.728	beta-carotene 15,15'-dioxygenase.

[back to server]