StarFunc result for job id Q9HAZ2

User Input

>input (1276 residues)
MRSKARARKLAKSDGDVVNNMYEPNRDLLASHSAEDEAEDSAMSPIPVGPPSPFPTSEDF
TPKEGSPYEAPVYIPEDIPIPADFELRESSIPGAGLGVWAKRKMEAGERLGPCVVVPRAA
AKETDFGWEQILTDVEVSPQEGCITKISEDLGSEKFCVDANQAGAGSWLKYIRVACSCDD
QNLTMCQISEQIYYKVIKDIEPGEELLVHVKEGVYPLGTVPPGLDEEPTFRCDECDELFQ
SKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQAHECKDCERMFPNKYSLEQHM
VIHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPSNLQRHIRSQH
VGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADCR
TQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGGIFAPGLPLTPSPMMDKAKPSPSLNH
ASLGFNEYFPSRPHPGSLPFSTAPPTFPALTPGFPGIFPPSLYPRPPLLPPTSLLKSPLN
HTQDAKLPSPLGNPALPLVSAVSNSSQGTTAAAGPEEKFESRLEDSCVEKLKTRSSDMSD
GSDFEDVNTTTGTDLDTTTGTGSDLDSDVDSDPDKDKGKGKSAEGQPKFGGGLAPPGAPN
SVAEVPVFYSQHSFFPPPDEQLLTATGAAGDSIKAIASIAEKYFGPGFMGMQEKKLGSLP
YHSAFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAECPFDLTTKPK
DVKPILPMPKGPSAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGLP
QVCPARMPQQPPLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEKYLRPSPLLFHPQMSA
IETMTEKLESFAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKIF
PRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQ
TNLDRHLKKHEHENAPVSQHPGVLTNHLGTSASSPTSESDNHALLDEKEDSYFSEIRNFI
ANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEEEDDDDLEEDDEDSLAGKSQD
DTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAEDHEGGLLALEPMPTFGKGLDLRR
AAEEAFEVKDVLNSTLDSEALKHTLCRQAKNQAYAMMLSLSEDTPLHTPSQGSLDAWLKV
TGATSESGAFHPINHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A935	0.326	0.326	0.000	1275	0.882	0.883	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
2	AFDB:P14404	0.239	0.246	0.000	1232	0.523	0.541	P14404.pdb.gz	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
3	AFDB:Q9HAZ2	1.000	1.000	0.000	1276	1.000	1.000	Q9HAZ2.pdb.gz	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
4	AFDB:A0A1W2PQA1	0.098	0.115	3.254E-14	1069	0.153	0.182	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
5	AFDB:O54963	0.119	0.139	1.204E-13	1069	0.151	0.181	O54963.pdb.gz	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
6	AFDB:A0A0R4INF0	0.081	0.072	7.810E-13	1570	0.164	0.133	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
7	AFDB:A2A7B5	0.073	0.055	4.201E-12	1709	0.201	0.150	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
8	AFDB:P19538	0.087	0.081	4.201E-12	1397	0.143	0.130	P19538.pdb.gz	CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster OX=7227 GN=ci PE=1 SV=2
9	AFDB:Q9P1Z0	0.079	0.093	5.737E-12	1013	0.154	0.193	Q9P1Z0.pdb.gz	ZBTB4_HUMAN Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3
10	AFDB:Q13029	0.074	0.057	1.005E-11	1718	0.195	0.145	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
11	PDB:3w5kB	0.045	0.267	1.734E-4	110	0.027	0.318	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:2g46A	0.053	0.476	1.128E-2	119	0.020	0.210	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
13	PDB:5h6zA	0.052	0.426	1.541E-2	123	0.016	0.163	5h6zA.pdb.gz
14	PDB:3qxyA	0.024	0.073	1.452E-1	420	0.003	0.010	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
15	PDB:5v3hA	0.040	0.104	2.111E-1	438	0.009	0.027	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
16	PDB:1pegA	0.047	0.214	2.246E-1	266	0.017	0.083	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
17	PDB:5ex0A	0.032	0.092	2.246E-1	429	0.007	0.021	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
18	PDB:5hynA	0.056	0.118	3.067E-1	581	0.013	0.028	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
19	PDB:6ox1B	0.020	0.051	6.088E-1	484	0.006	0.017	6ox1B.pdb.gz	Structural basis for the target specificity of actin histidine methyltransferase SETD3.
20	PDB:5wg6A	0.032	0.077	6.479E-1	517	0.006	0.015	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C3SFZ7	0.0	1022	1052	0.451	0.547	A0A0C3SFZ7_HUMAN MDS1 and EVI1 complex locus OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=1
2	A2A935	0.0	2172	1275	0.882	0.883	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
3	B7ZRU9	0.0	974	1055	0.451	0.545	EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis OX=8355 GN=mecom-a PE=1 SV=1
4	D6RDW0	0.0	2425	1178	0.920	0.997	D6RDW0_HUMAN PR/SET domain 16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=1
5	D6RFY3	0.0	2418	1177	0.919	0.997	D6RFY3_HUMAN PR/SET domain 16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=1
6	E7EUL6	0.0	1004	1003	0.435	0.553	E7EUL6_HUMAN MDS1 and EVI1 complex locus OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=1
7	H0YA13	0.0	2234	1084	0.850	1.000	H0YA13_HUMAN PR/SET domain 16 (Fragment) OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=1
8	P14404	0.0	1207	1232	0.527	0.546	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
9	Q03112	0.0	1223	1230	0.533	0.553	MECOM_HUMAN Histone-lysine N-methyltransferase MECOM OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=3
10	Q9HAZ2	0.0	2637	1276	1.000	1.000	PRD16_HUMAN Histone-lysine N-methyltransferase PRDM16 OS=Homo sapiens OX=9606 GN=PRDM16 PE=1 SV=3
11	Q8I7Z8	4.20e-56	214	990	0.078	0.100	HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1
12	Q6ZNH5	3.11e-37	149	498	0.093	0.239	ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens OX=9606 GN=ZNF497 PE=1 SV=2
13	P10073	3.36e-36	146	491	0.067	0.173	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
14	Q14593	7.35e-36	147	569	0.063	0.141	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
15	Q8NF99	2.87e-35	144	534	0.070	0.167	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
16	Q96JC4	4.80e-35	144	524	0.068	0.166	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
17	Q8IYB9	5.93e-35	145	648	0.067	0.131	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
18	Q96EG3	8.43e-35	143	531	0.068	0.164	ZN837_HUMAN Zinc finger protein 837 OS=Homo sapiens OX=9606 GN=ZNF837 PE=1 SV=2
19	Q923T4	1.76e-34	141	484	0.058	0.153	Q923T4_MOUSE Zinc finger protein ZFEND OS=Mus musculus OX=10090 GN=Zfp358 PE=2 SV=1
20	F1MAL7	3.51e-34	142	589	0.066	0.143	F1MAL7_RAT Zinc finger protein 386 (Kruppel-like) OS=Rattus norvegicus OX=10116 GN=Zfp386 PE=4 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09237 GAGA	4e+02	12.4	GAGA factor
2	PF00856 SET	3.9	19.3	SET domain
3	PF02892 zf-BED	8.4	17.8	BED zinc finger
4	PF00096 zf-C2H2	4.2e-43	154.6	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	2.8e-05	35.1	zinc-finger C2H2-type
6	PF13894 zf-C2H2_4	2.4e-27	104.3	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	1.9e-07	42.2	C2H2-type zinc finger
8	PF15909 zf-C2H2_8	4.4e+02	12.6	C2H2-type zinc ribbon
9	PF12171 zf-C2H2_jaz	3.3e-07	41.7	Zinc-finger double-stranded RNA-binding
10	PF13465 zf-H2C2_2	2e-23	92.9	Zinc-finger double domain
11	PF13909 zf-H2C2_5	4.6e-06	37.6	C2H2-type zinc-finger domain
12	PF12874 zf-met	6.1e+02	12.2	Zinc-finger of C2H2 type
13	PF17032 zinc_ribbon_15	3.3e+02	13.5	zinc-ribbon family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000270722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287820	0.990	Peroxisome proliferator-activated receptor gamma
2	9606.ENSP00000290921	0.990	C-terminal-binding protein 1
3	9606.ENSP00000305422	0.990	CCAAT/enhancer-binding protein beta
4	9606.ENSP00000264867	0.988	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
5	9606.ENSP00000417980	0.973	Histone-lysine N-methyltransferase EHMT1
6	9606.ENSP00000383042	0.971	Lysine-specific histone demethylase 1A
7	9606.ENSP00000320209	0.881	Cell death activator CIDE-A
8	9606.ENSP00000262999	0.880	Mitochondrial brown fat uncoupling protein 1
9	9606.ENSP00000394757	0.866	Zinc finger protein 516
10	9606.ENSP00000332973	0.811	Mothers against decapentaplegic homolog 3
11	9606.ENSP00000382237	0.808	Transmembrane protein 26
12	9606.ENSP00000430241	0.768	Transcription factor COE2
13	9606.ENSP00000450980	0.764	Responsible for the deiodination of T4 (3,5,3',5'- tetraiodothyronine)
14	9606.ENSP00000228644	0.735	Myogenic factor 5
15	9606.ENSP00000427514	0.732	CCAAT/enhancer-binding protein alpha
16	9606.ENSP00000385523	0.731	Peroxisome proliferator-activated receptor alpha
17	9606.ENSP00000359022	0.722	Elongation of very long chain fatty acids protein 3
18	9606.ENSP00000343782	0.719	Beta-3 adrenergic receptor
19	9606.ENSP00000282030	0.692	SET binding protein 1
20	9606.ENSP00000382595	0.692	Multifunctional protein ADE2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0018024	0.999	histone lysine N-methyltransferase activity
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0008134	0.996	transcription factor binding
GO:0001227	0.989	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0140297	0.941	DNA-binding transcription factor binding
GO:0001228	0.751	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0140938	0.726	histone H3 methyltransferase activity
GO:0046974	0.693	histone H3K9 methyltransferase activity
GO:0000977	0.424	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.331	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.301	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0010468	0.993	regulation of gene expression
GO:1903506	0.991	regulation of nucleic acid-templated transcription
GO:0006355	0.954	regulation of DNA-templated transcription
GO:0048519	0.951	negative regulation of biological process
GO:0048518	0.933	positive regulation of biological process
GO:0048523	0.933	negative regulation of cellular process
GO:0009987	0.910	cellular process
GO:0006357	0.908	regulation of transcription by RNA polymerase II
GO:0009892	0.906	negative regulation of metabolic process
GO:0010605	0.893	negative regulation of macromolecule metabolic process
GO:0031324	0.889	negative regulation of cellular metabolic process
GO:0051172	0.888	negative regulation of nitrogen compound metabolic process
GO:0009890	0.882	negative regulation of biosynthetic process
GO:0010558	0.866	negative regulation of macromolecule biosynthetic process
GO:0045934	0.866	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.862	negative regulation of cellular biosynthetic process
GO:0051253	0.862	negative regulation of RNA metabolic process
GO:0048522	0.854	positive regulation of cellular process
GO:0009893	0.830	positive regulation of metabolic process
GO:1902679	0.799	negative regulation of RNA biosynthetic process
GO:0045892	0.792	negative regulation of DNA-templated transcription
GO:0009966	0.787	regulation of signal transduction
GO:0010604	0.750	positive regulation of macromolecule metabolic process
GO:0031325	0.748	positive regulation of cellular metabolic process
GO:0045893	0.708	positive regulation of DNA-templated transcription
GO:0009968	0.682	negative regulation of signal transduction
GO:0045595	0.649	regulation of cell differentiation
GO:0032501	0.502	multicellular organismal process
GO:0051239	0.464	regulation of multicellular organismal process
GO:0032502	0.454	developmental process
GO:0048856	0.396	anatomical structure development
GO:0000122	0.372	negative regulation of transcription by RNA polymerase II
GO:0050896	0.357	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0005829	0.990	cytosol
GO:0016235	0.895	aggresome
GO:0032991	0.357	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]