StarFunc result for job id Q9HB03

User Input

>input (270 residues)
MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKG
FNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVF
LLSKVIELGDTAFIILRKRPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVTMNFGVHAI
MYTYYTLKAANVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSF
ILYMTYFILFAHFFCQTYIRPKVKAKTKSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HB03	1.000	1.000	7.942E-35	270	1.000	1.000	Q9HB03.pdb.gz	ELOV3_HUMAN Elongation of very long chain fatty acids protein 3 OS=Homo sapiens OX=9606 GN=ELOVL3 PE=1 SV=2
2	AFDB:O35949	0.926	0.922	2.483E-26	271	0.693	0.690	O35949.pdb.gz	ELOV3_MOUSE Elongation of very long chain fatty acids protein 3 OS=Mus musculus OX=10090 GN=Elovl3 PE=1 SV=1
3	AFDB:Q920L5	0.887	0.897	1.980E-18	267	0.422	0.427	Q920L5.pdb.gz	ELOV6_MOUSE Elongation of very long chain fatty acids protein 6 OS=Mus musculus OX=10090 GN=Elovl6 PE=1 SV=1
4	AFDB:Q9VV87	0.898	0.772	3.057E-16	316	0.400	0.342	Q9VV87.pdb.gz	ELOV6_DROME Elongation of very long chain fatty acids protein 6 OS=Drosophila melanogaster OX=7227 GN=Baldspot PE=1 SV=2
5	AFDB:Q9XVQ9	0.836	0.824	3.080E-14	274	0.311	0.307	Q9XVQ9.pdb.gz	ELO2_CAEEL Elongation of long chain fatty acids protein 2 OS=Caenorhabditis elegans OX=6239 GN=elo-2 PE=1 SV=1
6	AFDB:G5EEE5	0.819	0.771	5.844E-14	288	0.293	0.274	G5EEE5.pdb.gz	ELO1_CAEEL Elongation of long chain fatty acids protein 1 OS=Caenorhabditis elegans OX=6239 GN=elo-1 PE=1 SV=1
7	AFDB:Q57UP6	0.799	0.721	1.071E-11	301	0.315	0.282	Q57UP6.pdb.gz	Q57UP6_TRYB2 Elongation of fatty acids protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.400 PE=3 SV=1
8	AFDB:Q4QFS0	0.831	0.803	5.425E-11	280	0.256	0.246	Q4QFS0.pdb.gz	Q4QFS0_LEIMA Elongation of fatty acids protein OS=Leishmania major OX=5664 GN=ELO1.1 PE=3 SV=1
9	AFDB:Q57UP7	0.848	0.845	2.318E-10	271	0.293	0.292	Q57UP7.pdb.gz	Q57UP7_TRYB2 Elongation of fatty acids protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.380 PE=3 SV=1
10	AFDB:Q4QFR8	0.793	0.756	3.553E-10	284	0.270	0.257	Q4QFR8.pdb.gz	Q4QFR8_LEIMA Elongation of fatty acids protein OS=Leishmania major OX=5664 GN=ELO1.3 PE=3 SV=1
11	PDB:6y7fB	0.685	0.720	1.408E-7	256	0.207	0.219	6y7fB.pdb.gz	Crystal structure of human ELOVL fatty acid elongase 7 (ELOVL7)
12	PDB:7vadA	0.149	0.138	1.267E-1	306	0.148	0.131	7vadA.pdb.gz
13	PDB:7jm7A	0.182	0.097	2.026E-1	683	0.159	0.063	7jm7A.pdb.gz	Cryo-EM structure of the lysosomal chloride-proton exchanger CLC-7 in complex with OSTM1.
14	PDB:7cxrA	0.379	0.343	3.241E-1	307	0.078	0.068	7cxrA.pdb.gz
15	PDB:5xezB	0.241	0.168	6.700E-1	499	0.130	0.070	5xezB.pdb.gz	Structure of the full-length glucagon class B G-protein-coupled receptor.
16	PDB:4k1cA	0.155	0.126	7.297E-1	374	0.141	0.102	4k1cA.pdb.gz	Structural basis for alternating access of a eukaryotic calcium/proton exchanger.
17	PDB:4cy4E	0.141	0.124	7.615E-1	317	0.107	0.091	4cy4E.pdb.gz
18	PDB:7f73A	0.323	0.304	7.948E-1	293	0.115	0.106	7f73A.pdb.gz
19	PDB:7ungA3	0.188	0.155	8.656E-1	333	0.115	0.093	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
20	PDB:6xboA	0.152	0.139	9.034E-1	319	0.148	0.125	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HB03	0.0	558	270	1.000	1.000	ELOV3_HUMAN Elongation of very long chain fatty acids protein 3 OS=Homo sapiens OX=9606 GN=ELOVL3 PE=1 SV=2
2	O35949	5.17e-136	386	271	0.693	0.690	ELOV3_MOUSE Elongation of very long chain fatty acids protein 3 OS=Mus musculus OX=10090 GN=Elovl3 PE=1 SV=1
3	Q9H5J4	1.81e-80	245	265	0.437	0.445	ELOV6_HUMAN Elongation of very long chain fatty acids protein 6 OS=Homo sapiens OX=9606 GN=ELOVL6 PE=1 SV=1
4	Q920L5	2.43e-78	239	267	0.437	0.442	ELOV6_MOUSE Elongation of very long chain fatty acids protein 6 OS=Mus musculus OX=10090 GN=Elovl6 PE=1 SV=1
5	Q920L6	8.35e-73	225	267	0.437	0.442	ELOV6_RAT Elongation of very long chain fatty acids protein 6 OS=Rattus norvegicus OX=10116 GN=Elovl6 PE=1 SV=1
6	Q9VV87	2.36e-66	211	316	0.400	0.342	ELOV6_DROME Elongation of very long chain fatty acids protein 6 OS=Drosophila melanogaster OX=7227 GN=Baldspot PE=1 SV=2
7	Q9XVQ9	2.20e-47	160	274	0.326	0.321	ELO2_CAEEL Elongation of long chain fatty acids protein 2 OS=Caenorhabditis elegans OX=6239 GN=elo-2 PE=1 SV=1
8	G5EEE5	4.89e-41	144	288	0.307	0.288	ELO1_CAEEL Elongation of long chain fatty acids protein 1 OS=Caenorhabditis elegans OX=6239 GN=elo-1 PE=1 SV=1
9	Q57UP6	4.07e-38	137	301	0.315	0.282	Q57UP6_TRYB2 Elongation of fatty acids protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.400 PE=3 SV=1
10	Q57UP7	8.87e-33	122	271	0.311	0.310	Q57UP7_TRYB2 Elongation of fatty acids protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.380 PE=3 SV=1
11	Q57UP8	6.05e-28	110	305	0.259	0.230	Q57UP8_TRYB2 Elongation of fatty acids protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.370 PE=3 SV=1
12	Q4QFR8	8.04e-20	88.6	284	0.259	0.246	Q4QFR8_LEIMA Elongation of fatty acids protein OS=Leishmania major OX=5664 GN=ELO1.3 PE=3 SV=1
13	Q4QFS0	1.03e-19	88.2	280	0.252	0.243	Q4QFS0_LEIMA Elongation of fatty acids protein OS=Leishmania major OX=5664 GN=ELO1.1 PE=3 SV=1
14	A0A060WBM3	4.26e-18	84.0	295	0.281	0.258	A0A060WBM3_ONCMY Elongation of very long chain fatty acids protein 5 OS=Oncorhynchus mykiss OX=8022 GN=ELOVL5 PE=3 SV=1
15	B6V6V0	4.51e-18	84.0	294	0.285	0.262	B6V6V0_SALSA Elongation of very long chain fatty acids protein 5 OS=Salmo salar OX=8030 GN=LOC100192340 PE=2 SV=1
16	Q6P978	2.95e-17	81.6	303	0.319	0.284	Q6P978_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=elovl4 PE=2 SV=1
17	Q4QFR9	4.43e-17	80.9	285	0.241	0.228	Q4QFR9_LEIMA Elongation of fatty acids protein OS=Leishmania major OX=5664 GN=ELO1.2 PE=3 SV=1
18	D9IVG8	1.49e-16	79.7	306	0.315	0.278	D9IVG8_SALSA Elongation of very long chain fatty acids protein 4 OS=Salmo salar OX=8030 GN=elovl4 PE=2 SV=1
19	Q8AX86	6.76e-16	77.8	291	0.285	0.265	Q8AX86_DANRE Elongation of very long chain fatty acids protein 5 OS=Danio rerio OX=7955 GN=zgc:63549 PE=2 SV=2
20	Q9JLJ5	7.15e-16	77.8	279	0.304	0.294	ELOV1_MOUSE Elongation of very long chain fatty acids protein 1 OS=Mus musculus OX=10090 GN=Elovl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01151 ELO	2.2e-64	228.9	GNS1/SUR4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359022

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278353	0.936	Very-long-chain 3-oxoacyl-CoA reductase
2	9606.ENSP00000477602	0.865	Elongation of very long chain fatty acids protein 1
3	9606.ENSP00000424123	0.851	Elongation of very long chain fatty acids protein 7
4	9606.ENSP00000320209	0.827	Cell death activator CIDE-A
5	9606.ENSP00000262999	0.804	Mitochondrial brown fat uncoupling protein 1
6	9606.ENSP00000270722	0.722	PR domain zinc finger protein 16
7	9606.ENSP00000450980	0.715	Responsible for the deiodination of T4 (3,5,3',5'- tetraiodothyronine)
8	9606.ENSP00000328036	0.701	Diacylglycerol O-acyltransferase 2-like protein 6
9	9606.ENSP00000292907	0.683	Cytochrome c oxidase subunit 7A1, mitochondrial
10	9606.ENSP00000264867	0.677	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
11	9606.ENSP00000363645	0.657	Acyl-CoA wax alcohol acyltransferase 1
12	9606.ENSP00000359380	0.630	Acyl-CoA desaturase
13	9606.ENSP00000271688	0.603	Ceramide synthase 2
14	9606.ENSP00000296358	0.599	Otopetrin-1
15	9606.ENSP00000304592	0.589	Fatty acid synthase
16	9606.ENSP00000368362	0.580	Fatty acid binding protein family
17	9606.ENSP00000382237	0.580	Transmembrane protein 26
18	9606.ENSP00000421172	0.570	Acyl-CoA wax alcohol acyltransferase 2
19	9606.ENSP00000256104	0.568	Fatty acid-binding protein, adipocyte
20	9606.ENSP00000385523	0.566	Peroxisome proliferator-activated receptor alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0009922	1.000	fatty acid elongase activity
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006633	0.979	fatty acid biosynthetic process
GO:0030497	0.908	fatty acid elongation
GO:1901568	0.848	fatty acid derivative metabolic process
GO:0006637	0.847	acyl-CoA metabolic process
GO:0000038	0.839	very long-chain fatty acid metabolic process
GO:0071616	0.837	acyl-CoA biosynthetic process
GO:0035337	0.833	fatty-acyl-CoA metabolic process
GO:0042761	0.792	very long-chain fatty acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14993	1.000	acetyl-CoA + 2n H(+) + n malonyl-CoA + 2n NADPH = a long-chain fatty acid + n CO2 + (n+1) CoA + 2n NADP(+)
EC:2.3.1.85	1.000	fatty-acid synthase system.

[back to server]