StarFunc result for job id Q9HB09

User Input

>input (334 residues)
MGRPAGLFPPLCPFLGFRPEACWERHMQIERAPSVPPFLRWAGYRPGPVRRRGKVELIKF
VRVQWRRPQVEWRRRRWGPGPGASMAGSEELGLREDTLRVLAAFLRRGEAAGSPVPTPPR
SPAQEEPTDFLSRLRRCLPCSLGRGAAPSESPRPCSLPIRPCYGLEPGPATPDFYALVAQ
RLEQLVQEQLKSPPSPELQGPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVR
LSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGL
SVEHVHSFTPWIQAHGGWEGILAVSPVDLNLPLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HB09	1.000	1.000	7.172E-54	334	1.000	1.000	Q9HB09.pdb.gz	B2L12_HUMAN Bcl-2-like protein 12 OS=Homo sapiens OX=9606 GN=BCL2L12 PE=1 SV=1
2	AFDB:Q9D3J3	0.196	0.246	3.151E-28	255	0.629	0.824	Q9D3J3.pdb.gz	Q9D3J3_MOUSE BCL2-like 12 (proline rich) OS=Mus musculus OX=10090 GN=Bcl2l12 PE=1 SV=1
3	AFDB:Q21148	0.106	0.116	2.591E-3	308	0.105	0.114	Q21148.pdb.gz	ZIP2_CAEEL Transcription factor zip-2 OS=Caenorhabditis elegans OX=6239 GN=zip-2 PE=1 SV=2
4	AFDB:O59732	0.114	0.089	9.404E-3	456	0.174	0.127	O59732.pdb.gz	CHR1_SCHPO Chitin synthase regulatory factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chr1 PE=1 SV=1
5	AFDB:X2JCF3	0.075	0.066	1.070E-2	581	0.114	0.065	X2JCF3.pdb.gz	X2JCF3_DROME Rho GTPase activating protein at 16F, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP16F PE=4 SV=1
6	AFDB:Q8C6A8	0.082	0.077	1.477E-2	355	0.147	0.138	Q8C6A8.pdb.gz	BHE22_MOUSE Class E basic helix-loop-helix protein 22 OS=Mus musculus OX=10090 GN=Bhlhe22 PE=1 SV=1
7	AFDB:F4HZ25	0.102	0.056	1.792E-2	668	0.162	0.081	F4HZ25.pdb.gz	F4HZ25_ARATH Sec14p-like phosphatidylinositol transfer family protein OS=Arabidopsis thaliana OX=3702 GN=At1g75370 PE=1 SV=1
8	AFDB:Q8GXC2	0.127	0.110	1.911E-2	397	0.126	0.106	Q8GXC2.pdb.gz	PHL4_ARATH Myb family transcription factor PHL4 OS=Arabidopsis thaliana OX=3702 GN=PHL4 PE=2 SV=1
9	AFDB:F8W3F6	0.104	0.082	2.038E-2	458	0.159	0.116	F8W3F6.pdb.gz
10	AFDB:Q9VHE3	0.120	0.094	2.638E-2	448	0.132	0.098	Q9VHE3.pdb.gz	Q9VHE3_DROME GH05665p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9356 PE=1 SV=1
11	PDB:2k7wA	0.143	0.228	9.442E-2	192	0.108	0.188	2k7wA.pdb.gz	BAX activation is initiated at a novel interaction site.
12	PDB:4ytpC	0.117	0.200	2.222	138	0.057	0.138	4ytpC.pdb.gz	Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
13	PDB:4v88Ah	0.071	0.103	3.067	159	0.063	0.132	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.
14	PDB:2marA	0.108	0.259	3.272	134	0.069	0.172	2marA.pdb.gz
15	PDB:7n9fR	0.096	0.055	3.272	708	0.114	0.054	7n9fR.pdb.gz
16	PDB:6ff7K	0.089	0.129	3.489	213	0.096	0.150	6ff7K.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:6id0L	0.090	0.070	3.489	475	0.111	0.078	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:1oqyA	0.119	0.112	4.516	363	0.141	0.129	1oqyA.pdb.gz
19	PDB:7mqaNS	0.073	0.033	4.516	914	0.045	0.016	7mqaNS.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7pikC	0.079	0.052	4.516	557	0.087	0.052	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HB09	0.0	649	334	1.000	1.000	B2L12_HUMAN Bcl-2-like protein 12 OS=Homo sapiens OX=9606 GN=BCL2L12 PE=1 SV=1
2	Q9D3J3	1.50e-117	341	255	0.629	0.824	Q9D3J3_MOUSE BCL2-like 12 (proline rich) OS=Mus musculus OX=10090 GN=Bcl2l12 PE=1 SV=1
3	Q8CHQ5	2.14e-70	219	187	0.389	0.695	Q8CHQ5_MOUSE Bcl2l12 protein OS=Mus musculus OX=10090 GN=Bcl2l12 PE=2 SV=1
4	A0A140LIT0	9.48e-64	201	148	0.356	0.804	A0A140LIT0_MOUSE BCL2-like 12 (proline rich) (Fragment) OS=Mus musculus OX=10090 GN=Bcl2l12 PE=1 SV=1
5	A0A140LHT8	2.17e-58	186	115	0.284	0.826	A0A140LHT8_MOUSE BCL2-like 12 (proline rich) OS=Mus musculus OX=10090 GN=Bcl2l12 PE=1 SV=1
6	A0A140LHC2	9.04e-40	137	83	0.210	0.843	A0A140LHC2_MOUSE BCL2-like 12 (proline rich) (Fragment) OS=Mus musculus OX=10090 GN=Bcl2l12 PE=1 SV=2
7	Q9BZR8	4.72e-05	47.0	327	0.099	0.101	B2L14_HUMAN Apoptosis facilitator Bcl-2-like protein 14 OS=Homo sapiens OX=9606 GN=BCL2L14 PE=1 SV=1
8	K7EMX4	5.12e-05	47.0	360	0.099	0.092	K7EMX4_HUMAN Apoptosis facilitator Bcl-2-like protein 14 OS=Homo sapiens OX=9606 GN=BCL2L14 PE=1 SV=1
9	Q9CPT0	1.01e-04	45.8	328	0.093	0.095	B2L14_MOUSE Apoptosis facilitator Bcl-2-like protein 14 OS=Mus musculus OX=10090 GN=Bcl2l14 PE=1 SV=1
10	P33892	1.3	33.5	2672	0.063	0.008	GCN1_YEAST eIF-2-alpha kinase activator GCN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GCN1 PE=1 SV=1
11	Q5GA22	2.0	32.7	379	0.054	0.047	MIK_MAIZE Inositol 3-kinase OS=Zea mays OX=4577 GN=MIK PE=1 SV=1
12	Q17423	2.1	32.7	1282	0.105	0.027	CREC_CAEEL Crescerin-like protein che-12 OS=Caenorhabditis elegans OX=6239 GN=che-12 PE=1 SV=3
13	O08614	2.4	32.7	3429	0.123	0.012	O08614_MOUSE Cytoskeletal protein OS=Mus musculus OX=10090 GN=Utrn PE=2 SV=1
14	P0C671	2.4	32.7	652	0.057	0.029	BNIP5_HUMAN Protein BNIP5 OS=Homo sapiens OX=9606 GN=BNIP5 PE=1 SV=1
15	Q9P2E9	4.6	31.6	1410	0.042	0.010	RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5
16	Q9VWE0	4.6	31.6	1282	0.060	0.016	DOME_DROME Cytokine receptor OS=Drosophila melanogaster OX=7227 GN=dome PE=1 SV=1
17	Q6R3M4	5.4	31.6	717	0.093	0.043	POLI_MOUSE DNA polymerase iota OS=Mus musculus OX=10090 GN=Poli PE=1 SV=1
18	B7G620	5.7	31.2	548	0.084	0.051	IDH1_PHATC Isocitrate dehydrogenase [NAD(+)] 1, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) OX=556484 GN=IDH1 PE=1 SV=2
19	Q2M1P5	8.2	30.8	1343	0.060	0.015	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
20	Q9QWS8	9.3	30.8	1102	0.141	0.043	KCNH8_RAT Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus OX=10116 GN=Kcnh8 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15661 CF222	3.1e+02	11.6	C6orf222, uncharacterised family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482218

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.868	Cellular tumor antigen p53
2	9606.ENSP00000358327	0.761	Caspase-7
3	9606.ENSP00000394510	0.738	Proline-rich protein 12
4	9606.ENSP00000353769	0.731	Splicing factor, arginine/serine-rich 19
5	9606.ENSP00000246794	0.729	Transmembrane gamma-carboxyglutamic acid protein 2
6	9606.ENSP00000302564	0.724	Bcl-2-like protein 1
7	9606.ENSP00000293288	0.710	Apoptosis regulator BAX
8	9606.ENSP00000246792	0.660	Ras-related protein R-Ras
9	9606.ENSP00000303580	0.638	NF-kappa-B inhibitor-interacting Ras-like protein 2
10	9606.ENSP00000389715	0.628	Kinase suppressor of Ras 2
11	9606.ENSP00000362170	0.624	Nuclear apoptosis-inducing factor 1
12	9606.ENSP00000314132	0.612	Bcl-2-related ovarian killer protein
13	9606.ENSP00000357305	0.604	GTP-binding protein Rit1
14	9606.ENSP00000406162	0.561	Protein arginine N-methyltransferase 1
15	9606.ENSP00000481450	0.560	Pancreatic alpha-amylase
16	9606.ENSP00000415430	0.557	G2 and S phase-expressed protein 1
17	9606.ENSP00000390011	0.526	Cytoplasmic tRNA 2-thiolation protein 1
18	9606.ENSP00000346414	0.525	Leucine rich repeats and IQ motif containing 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0051246	0.965	regulation of protein metabolic process
GO:0042981	0.961	regulation of apoptotic process
GO:0050790	0.958	regulation of catalytic activity
GO:0031323	0.952	regulation of cellular metabolic process
GO:0048518	0.949	positive regulation of biological process
GO:0043066	0.948	negative regulation of apoptotic process
GO:0048522	0.927	positive regulation of cellular process
GO:0030162	0.907	regulation of proteolysis
GO:0052548	0.898	regulation of endopeptidase activity
GO:2000116	0.892	regulation of cysteine-type endopeptidase activity
GO:0009893	0.871	positive regulation of metabolic process
GO:0051173	0.861	positive regulation of nitrogen compound metabolic process
GO:0010604	0.861	positive regulation of macromolecule metabolic process
GO:0009892	0.857	negative regulation of metabolic process
GO:0044092	0.841	negative regulation of molecular function
GO:0043281	0.833	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0010468	0.802	regulation of gene expression
GO:1903317	0.781	regulation of protein maturation
GO:0051172	0.765	negative regulation of nitrogen compound metabolic process
GO:0010605	0.756	negative regulation of macromolecule metabolic process
GO:0043086	0.742	negative regulation of catalytic activity
GO:0070613	0.650	regulation of protein processing
GO:0051248	0.630	negative regulation of protein metabolic process
GO:0010466	0.613	negative regulation of peptidase activity
GO:0010951	0.583	negative regulation of endopeptidase activity
GO:1903318	0.553	negative regulation of protein maturation
GO:0010955	0.525	negative regulation of protein processing
GO:0009987	0.412	cellular process
GO:0048583	0.380	regulation of response to stimulus
GO:0009966	0.372	regulation of signal transduction
GO:0019219	0.366	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.350	positive regulation of cellular metabolic process
GO:0050896	0.344	response to stimulus
GO:0045935	0.340	positive regulation of nucleobase-containing compound metabolic process
GO:1902531	0.303	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005634	1.000	nucleus
GO:0005737	0.911	cytoplasm
GO:0005829	0.895	cytosol
GO:0031981	0.340	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]