StarFunc result for job id Q9HB19

User Input

>input (425 residues)
MPYVDRQNRICGFLDIEEHENSGKFLRRYFILDTQANCLLWYMDNPQNLAMGAGAVGALQ
LTYISKVSIATPKQKPKTPFCFVINALSQRYFLQANDQKDMKDWVEALNQASKITVPKGG
GLPMTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILR
RSQSYIPTSGCRASTGPPLIKSGYCVKQGNVRKSWKRRFFALDDFTICYFKCEQDREPLR
TIFLKDVLKTHECLVKSGDLLMRDNLFEIITSSRTFYVQADSPEDMHSWIKEIGAAVQAL
KCHPRETSFSRSISLTRPGSSSLSSGPNSILCRGRPPLEEKKALCKAPSVASSWQPWTPV
PQAGEKLLPPGDTSEDSLFTPRPGEGAPPGVLPSSRIRHRSEPQHPKEKPFMFNLDDENI
RTSDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HB19	1.000	1.000	3.875E-73	425	1.000	1.000	Q9HB19.pdb.gz	PKHA2_HUMAN Pleckstrin homology domain-containing family A member 2 OS=Homo sapiens OX=9606 GN=PLEKHA2 PE=1 SV=2
2	AFDB:Q9ERS5	0.289	0.289	2.021E-64	425	0.885	0.885	Q9ERS5.pdb.gz	PKHA2_MOUSE Pleckstrin homology domain-containing family A member 2 OS=Mus musculus OX=10090 GN=Plekha2 PE=1 SV=1
3	AFDB:Q9HB21	0.287	0.302	1.345E-41	404	0.454	0.478	Q9HB21.pdb.gz	PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=2
4	AFDB:Q5RGS4	0.296	0.326	3.887E-40	383	0.449	0.499	Q5RGS4.pdb.gz	Q5RGS4_HUMAN Pleckstrin homology domain containing A1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=1
5	PDB:3ljuX	0.217	0.246	2.029E-10	373	0.115	0.131	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
6	AFDB:Q9DF49	0.235	0.103	1.506E-8	1074	0.148	0.059	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
7	AFDB:Q9VGI1	0.213	0.072	7.555E-7	1354	0.134	0.042	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
8	PDB:4mk0A	0.221	0.151	9.894E-7	631	0.056	0.038	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
9	AFDB:F1Q7S5	0.230	0.135	1.052E-6	740	0.132	0.076	F1Q7S5.pdb.gz	F1Q7S5_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=1
10	PDB:6bbpA	0.200	0.165	1.105E-6	520	0.073	0.060	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
11	PDB:6u3eA	0.206	0.221	1.167E-6	397	0.073	0.078	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
12	AFDB:A0A140LH27	0.207	0.054	1.826E-6	1664	0.101	0.026	A0A140LH27.pdb.gz	A0A140LH27_DANRE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 isoform X1 OS=Danio rerio OX=7955 GN=arap3 PE=4 SV=1
13	AFDB:F6NTT0	0.231	0.140	1.826E-6	712	0.127	0.076	F6NTT0.pdb.gz	F6NTT0_DANRE GRB2-associated-binding protein 1 OS=Danio rerio OX=7955 GN=fb11b01 PE=3 SV=2
14	AFDB:C6JUQ2	0.223	0.134	2.405E-6	721	0.139	0.082	C6JUQ2.pdb.gz	C6JUQ2_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=1
15	PDB:3pvuA	0.216	0.153	7.612E-6	609	0.056	0.039	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
16	PDB:6hhgA	0.208	0.228	8.981E-6	386	0.056	0.062	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:3uzsA	0.226	0.161	1.120E-5	609	0.066	0.046	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
18	PDB:6s9wA	0.199	0.205	5.856E-5	411	0.054	0.056	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
19	PDB:7rx9A	0.208	0.205	1.199E-4	432	0.042	0.042	7rx9A.pdb.gz
20	PDB:6xtbE	0.187	0.322	1.580E-4	235	0.087	0.157	6xtbE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ERS5	0.0	783	425	0.885	0.885	PKHA2_MOUSE Pleckstrin homology domain-containing family A member 2 OS=Mus musculus OX=10090 GN=Plekha2 PE=1 SV=1
2	Q9HB19	0.0	883	425	1.000	1.000	PKHA2_HUMAN Pleckstrin homology domain-containing family A member 2 OS=Homo sapiens OX=9606 GN=PLEKHA2 PE=1 SV=2
3	Q8BUL6	5.69e-114	340	383	0.414	0.460	PKHA1_MOUSE Pleckstrin homology domain-containing family A member 1 OS=Mus musculus OX=10090 GN=Plekha1 PE=1 SV=1
4	Q5RGS4	7.14e-113	338	383	0.409	0.454	Q5RGS4_HUMAN Pleckstrin homology domain containing A1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=1
5	Q9HB21	7.75e-113	338	404	0.407	0.428	PKHA1_HUMAN Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=2
6	Q00IB7	3.13e-09	61.6	1433	0.099	0.029	PKHH1_DANRE Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1
7	Q9ST43	3.02e-08	54.7	145	0.071	0.207	PH1_ARATH Pleckstrin homology domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PH1 PE=2 SV=2
8	Q8IVE3	3.11e-08	58.5	1493	0.085	0.024	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
9	Q8C115	3.54e-08	58.2	1491	0.085	0.024	PKHH2_MOUSE Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3
10	Q9UQC2	8.40e-08	57.0	676	0.071	0.044	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1
11	Q9Z1S8	1.46e-07	56.2	665	0.071	0.045	GAB2_MOUSE GRB2-associated-binding protein 2 OS=Mus musculus OX=10090 GN=Gab2 PE=1 SV=2
12	Q9EQH1	1.65e-07	55.8	665	0.071	0.045	GAB2_RAT GRB2-associated-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Gab2 PE=1 SV=2
13	Q9VMI6	1.74e-07	54.7	296	0.073	0.105	Q9VMI6_DROME Inositol phosphatase interacting protein, isoform A OS=Drosophila melanogaster OX=7227 GN=IPIP PE=4 SV=1
14	Q9Y2H5	1.80e-07	55.8	1048	0.075	0.031	PKHA6_HUMAN Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4
15	Q55GV3	2.86e-07	54.7	477	0.073	0.065	PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum OX=44689 GN=pakC PE=1 SV=2
16	P54644	4.81e-07	53.9	444	0.071	0.068	KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum OX=44689 GN=pkbA PE=1 SV=1
17	Q9UN19	5.07e-07	53.1	280	0.085	0.129	DAPP1_HUMAN Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide OS=Homo sapiens OX=9606 GN=DAPP1 PE=1 SV=1
18	P08567	1.07e-06	52.8	350	0.082	0.100	PLEK_HUMAN Pleckstrin OS=Homo sapiens OX=9606 GN=PLEK PE=1 SV=3
19	C6JUQ2	1.10e-06	53.1	721	0.068	0.040	C6JUQ2_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=1
20	D3ZAL7	1.14e-06	53.1	724	0.068	0.040	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12814 Mcp5_PH	0.79	21.3	Meiotic cell cortex C-terminal pleckstrin homology
2	PF00169 PH	2e-27	107.1	PH domain
3	PF15413 PH_11	4e-06	38.6	Pleckstrin homology domain
4	PF16652 PH_13	0.053	24.9	Pleckstrin homology domain
5	PF15409 PH_8	5.6e-05	34.7	Pleckstrin homology domain
6	PF15410 PH_9	0.0001	33.9	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482228

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000394794	0.913	Tyrosine-protein phosphatase non-receptor type 13
2	9606.ENSP00000439807	0.710	Multiple PDZ domain protein
3	9606.ENSP00000357986	0.689	Pleckstrin homology domain-containing family A member 1
4	9606.ENSP00000333593	0.649	Neurexophilin-4
5	9606.ENSP00000356515	0.614	Utrophin
6	9606.ENSP00000384551	0.601	Neurexophilin-1
7	9606.ENSP00000308057	0.584	Beta-synuclein
8	9606.ENSP00000298229	0.516	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
9	9606.ENSP00000303077	0.516	Putative aspartate aminotransferase, cytoplasmic 2
10	9606.ENSP00000468678	0.514	Pleckstrin homology, MyTH4 and FERM domain containing H3
11	9606.ENSP00000386137	0.503	Olfactory receptor 2A14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043325	1.000	phosphatidylinositol-3,4-bisphosphate binding
GO:0001968	0.906	fibronectin binding
GO:0043236	0.906	laminin binding
GO:0019904	0.302	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0010810	0.918	regulation of cell-substrate adhesion
GO:0045785	0.893	positive regulation of cell adhesion
GO:0009987	0.789	cellular process
GO:0001952	0.788	regulation of cell-matrix adhesion
GO:0010811	0.781	positive regulation of cell-substrate adhesion
GO:0001954	0.718	positive regulation of cell-matrix adhesion
GO:0071704	0.431	organic substance metabolic process
GO:0050896	0.404	response to stimulus
GO:0044238	0.316	primary metabolic process
GO:0051179	0.302	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0032991	0.972	protein-containing complex
GO:0043226	0.958	organelle
GO:0005829	0.955	cytosol
GO:0043227	0.918	membrane-bounded organelle
GO:0043229	0.903	intracellular organelle
GO:0043231	0.817	intracellular membrane-bounded organelle
GO:0120025	0.462	plasma membrane bounded cell projection
GO:0005634	0.408	nucleus
GO:0031982	0.368	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]