StarFunc result for job id Q9HB31

User Input

>input (190 residues)
MPSPVDASSADGGSGLGSHRRKRTTFSKGQLLELERAFAAWPYPNISTHEHLAWVTCLPE
AKVQVWFQKRWAKIIKNRKSGILSPGSECPQSSCSLPDTLQQPWDPQMPGQPPPSSGTPQ
RTSVCRHSSCPAPGLSPRQGWEGAKAVAPWGSAGASEVHPSLERATPQTSLGSLSDLIYA
LAIVVNVDHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70368	0.364	0.364	3.204E-16	190	0.626	0.626	P70368.pdb.gz	SEBOX_MOUSE Homeobox protein SEBOX OS=Mus musculus OX=10090 GN=Sebox PE=2 SV=2
2	AFDB:Q8JJ26	0.333	0.218	1.097E-7	293	0.389	0.253	Q8JJ26.pdb.gz	SEBOX_DANRE Homeobox protein SEBOX OS=Danio rerio OX=7955 GN=sebox PE=2 SV=2
3	AFDB:Q96IS3	0.355	0.366	4.047E-7	184	0.274	0.283	Q96IS3.pdb.gz	RAX2_HUMAN Retina and anterior neural fold homeobox protein 2 OS=Homo sapiens OX=9606 GN=RAX2 PE=1 SV=1
4	AFDB:O42358	0.290	0.192	8.859E-7	292	0.326	0.212	O42358.pdb.gz	RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio OX=7955 GN=rx3 PE=2 SV=1
5	AFDB:Q6QU75	0.320	0.214	1.150E-6	293	0.295	0.191	Q6QU75.pdb.gz	PITX3_DANRE Pituitary homeobox 3 OS=Danio rerio OX=7955 GN=pitx3 PE=2 SV=1
6	AFDB:Q504J3	0.340	0.206	1.594E-6	318	0.274	0.164	Q504J3.pdb.gz
7	AFDB:A1A546	0.368	0.297	1.702E-6	240	0.253	0.200	A1A546.pdb.gz	ISX_MOUSE Intestine-specific homeobox OS=Mus musculus OX=10090 GN=Isx PE=2 SV=2
8	AFDB:O57416	0.329	0.131	1.702E-6	509	0.311	0.116	O57416.pdb.gz	O57416_DANRE Paired box 3a OS=Danio rerio OX=7955 GN=pax3 PE=2 SV=1
9	AFDB:C0M005	0.323	0.130	1.939E-6	510	0.289	0.108	C0M005.pdb.gz	C0M005_DANRE Paired box 7b OS=Danio rerio OX=7955 GN=pax7b PE=2 SV=1
10	AFDB:P97474	0.320	0.198	2.070E-6	317	0.263	0.158	P97474.pdb.gz	PITX2_MOUSE Pituitary homeobox 2 OS=Mus musculus OX=10090 GN=Pitx2 PE=1 SV=2
11	PDB:2hi3A	0.263	0.616	5.826E-2	73	0.089	0.233	2hi3A.pdb.gz
12	PDB:4egcA	0.250	0.091	7.564E-2	539	0.074	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:7fbyA	0.159	0.193	4.409E-1	153	0.042	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:2cyyA	0.163	0.200	5.024E-1	151	0.047	0.060	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
15	PDB:5mrca	0.188	0.199	6.963E-1	177	0.074	0.079	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
16	PDB:5nr5A	0.196	0.309	7.934E-1	113	0.089	0.150	5nr5A.pdb.gz
17	PDB:5z56L	0.197	0.118	9.041E-1	342	0.058	0.032	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:2cg4A	0.172	0.214	9.651E-1	149	0.047	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
19	PDB:2vbwA	0.165	0.209	9.651E-1	147	0.063	0.082	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
20	PDB:5aj0BZ	0.209	0.413	1.524	86	0.037	0.081	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70368	8.72e-72	217	190	0.626	0.626	SEBOX_MOUSE Homeobox protein SEBOX OS=Mus musculus OX=10090 GN=Sebox PE=2 SV=2
2	Q8JJ26	2.67e-24	98.6	293	0.442	0.287	SEBOX_DANRE Homeobox protein SEBOX OS=Danio rerio OX=7955 GN=sebox PE=2 SV=2
3	Q21836	1.92e-15	75.1	362	0.205	0.108	ARXH_CAEEL Homeobox ARX homolog alr-1 OS=Caenorhabditis elegans OX=6239 GN=alr-1 PE=1 SV=1
4	O42356	3.16e-15	74.3	330	0.189	0.109	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
5	Q9H161	7.89e-15	73.6	411	0.205	0.095	ALX4_HUMAN Homeobox protein aristaless-like 4 OS=Homo sapiens OX=9606 GN=ALX4 PE=1 SV=2
6	G5EC89	2.77e-14	70.5	237	0.221	0.177	CEH17_CAEEL Homeobox protein ceh-17 OS=Caenorhabditis elegans OX=6239 GN=ceh-17 PE=1 SV=1
7	Q5I7G4	2.82e-14	71.2	284	0.179	0.120	Q5I7G4_DANRE Paired mesoderm homeobox protein 2B OS=Danio rerio OX=7955 GN=phox2b PE=2 SV=1
8	Q6NYV4	3.06e-14	71.2	277	0.195	0.134	Q6NYV4_DANRE Paired mesoderm homeobox protein 2A OS=Danio rerio OX=7955 GN=arix PE=2 SV=1
9	F1RCT9	3.18e-14	71.2	280	0.195	0.132	F1RCT9_DANRE Paired mesoderm homeobox protein 2A isoform X1 OS=Danio rerio OX=7955 GN=arix PE=4 SV=1
10	O35137	3.46e-14	72.0	399	0.200	0.095	ALX4_MOUSE Homeobox protein aristaless-like 4 OS=Mus musculus OX=10090 GN=Alx4 PE=1 SV=1
11	Q96IS3	4.29e-14	69.3	184	0.289	0.299	RAX2_HUMAN Retina and anterior neural fold homeobox protein 2 OS=Homo sapiens OX=9606 GN=RAX2 PE=1 SV=1
12	O42358	5.42e-14	70.5	292	0.211	0.137	RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio OX=7955 GN=rx3 PE=2 SV=1
13	A0A0G2JYE6	5.55e-14	70.9	314	0.179	0.108	A0A0G2JYE6_RAT Paired-like homeobox 2b OS=Rattus norvegicus OX=10116 GN=Phox2b PE=4 SV=2
14	O35690	5.55e-14	70.9	314	0.179	0.108	PHX2B_MOUSE Paired mesoderm homeobox protein 2B OS=Mus musculus OX=10090 GN=Phox2b PE=1 SV=1
15	Q99453	5.55e-14	70.9	314	0.179	0.108	PHX2B_HUMAN Paired mesoderm homeobox protein 2B OS=Homo sapiens OX=9606 GN=PHOX2B PE=1 SV=2
16	O42357	7.58e-14	70.5	327	0.168	0.098	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
17	L8E946	7.78e-14	70.1	279	0.205	0.140	UNC42_CAEEL Homeobox protein unc-42 OS=Caenorhabditis elegans OX=6239 GN=unc-42 PE=1 SV=1
18	O42115	8.49e-14	70.9	453	0.195	0.082	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
19	Q06453	1.31e-13	70.1	408	0.211	0.098	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
20	Q5TYX1	1.32e-13	69.7	327	0.211	0.122	Q5TYX1_DANRE Homeobox protein MIXL1 OS=Danio rerio OX=7955 GN=bon PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.7e-11	55.1	Homeodomain
2	PF02477 Nairo_nucleo	2.2e+02	12.1	Nucleocapsid N protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444503

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359212	0.685	Transcription factor LBX1
2	9606.ENSP00000335038	0.563	V-set and transmembrane domain containing 2B
3	9606.ENSP00000359384	0.559	Oocyte-expressed protein homolog
4	9606.ENSP00000301200	0.543	Cdc42 effector protein 5
5	9606.ENSP00000246112	0.535	Transducin-like enhancer protein 6
6	9606.ENSP00000297788	0.526	Coiled-coil domain-containing protein 136
7	9606.ENSP00000323455	0.518	Tetra-peptide repeat homeobox protein 1
8	9606.ENSP00000283474	0.515	UBA-like domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.998	protein binding
GO:0003700	0.995	DNA-binding transcription factor activity
GO:0000981	0.989	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.945	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.964	regulation of biological process
GO:0032502	0.960	developmental process
GO:0032501	0.931	multicellular organismal process
GO:0050794	0.859	regulation of cellular process
GO:0048856	0.801	anatomical structure development
GO:0009987	0.650	cellular process
GO:0019222	0.546	regulation of metabolic process
GO:0060255	0.490	regulation of macromolecule metabolic process
GO:0010468	0.483	regulation of gene expression
GO:0080090	0.409	regulation of primary metabolic process
GO:0051171	0.399	regulation of nitrogen compound metabolic process
GO:0031323	0.367	regulation of cellular metabolic process
GO:0019219	0.364	regulation of nucleobase-containing compound metabolic process
GO:0007275	0.360	multicellular organism development
GO:0048518	0.346	positive regulation of biological process
GO:0051252	0.330	regulation of RNA metabolic process
GO:0048522	0.316	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.943	nuclear lumen
GO:0043232	0.779	intracellular non-membrane-bounded organelle
GO:0005654	0.567	nucleoplasm
GO:0005737	0.446	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]