StarFunc result for job id Q9HB65

User Input

>input (397 residues)
MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRL
PGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIP
APSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSS
REHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSP
LQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQ
HAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFR
KQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HB65	1.000	1.000	1.910E-67	397	1.000	1.000	Q9HB65.pdb.gz	ELL3_HUMAN RNA polymerase II elongation factor ELL3 OS=Homo sapiens OX=9606 GN=ELL3 PE=1 SV=2
2	AFDB:Q80VR2	0.325	0.327	3.808E-48	395	0.763	0.767	Q80VR2.pdb.gz	ELL3_MOUSE RNA polymerase II elongation factor ELL3 OS=Mus musculus OX=10090 GN=Ell3 PE=1 SV=1
3	AFDB:C9JHD8	0.222	0.380	2.666E-24	206	0.443	0.854	C9JHD8.pdb.gz	C9JHD8_HUMAN Elongation factor for RNA polymerase II 3 (Fragment) OS=Homo sapiens OX=9606 GN=ELL3 PE=1 SV=1
4	AFDB:F6RA30	0.253	0.451	4.714E-7	206	0.113	0.218	F6RA30.pdb.gz	F6RA30_BOVIN Occludin/ELL domain containing 1 OS=Bos taurus OX=9913 GN=OCEL1 PE=3 SV=1
5	AFDB:Q91049	0.234	0.189	7.165E-7	504	0.121	0.095	Q91049.pdb.gz	OCLN_CHICK Occludin OS=Gallus gallus OX=9031 GN=OCLN PE=1 SV=1
6	PDB:7okxM	0.211	0.559	9.612E-7	139	0.073	0.209	7okxM.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
7	AFDB:Q9N554	0.248	0.150	1.303E-6	678	0.224	0.131	Q9N554.pdb.gz	Q9N554_CAEEL OCEL domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ell-1 PE=1 SV=2
8	AFDB:O76329	0.094	0.035	2.753E-3	1738	0.088	0.020	O76329.pdb.gz	ACTNB_DICDI Interaptin OS=Dictyostelium discoideum OX=44689 GN=abpD PE=1 SV=1
9	PDB:7a6hN	0.162	0.315	5.287E-3	186	0.055	0.118	7a6hN.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
10	PDB:7d58N	0.161	0.377	5.613E-3	136	0.043	0.125	7d58N.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
11	AFDB:Q9P7X2	0.158	0.123	5.643E-3	533	0.161	0.120	Q9P7X2.pdb.gz	ELL1_SCHPO RNA polymerase II elongation factor ell1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ell1 PE=1 SV=1
12	AFDB:Q709R6	0.088	0.088	9.666E-3	399	0.151	0.150	Q709R6.pdb.gz	BOCKS_DROME LEM domain-containing protein Bocksbeutel OS=Drosophila melanogaster OX=7227 GN=bocks PE=1 SV=1
13	PDB:6o9lT	0.172	0.267	1.971E-2	237	0.040	0.068	6o9lT.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
14	AFDB:Q3UPA6	0.095	0.040	2.672E-2	1018	0.194	0.076	Q3UPA6.pdb.gz	Q3UPA6_MOUSE Bromodomain PHD finger transcription factor (Fragment) OS=Mus musculus OX=10090 GN=Bptf PE=2 SV=1
15	PDB:7z1lN	0.143	0.324	4.289E-2	153	0.023	0.059	7z1lN.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
16	PDB:7vbaN	0.161	0.364	5.132E-2	151	0.053	0.139	7vbaN.pdb.gz	Structure of the human RNA polymerase I elongation complex.
17	PDB:7edxT	0.162	0.440	6.519E-2	113	0.033	0.115	7edxT.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
18	PDB:6s1cF	0.140	0.179	1.052E-1	299	0.035	0.047	6s1cF.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
19	PDB:7o4iR	0.141	0.197	1.052E-1	268	0.033	0.049	7o4iR.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
20	PDB:6s1cB	0.130	0.148	1.599E-1	342	0.038	0.044	6s1cB.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80VR2	0.0	560	395	0.753	0.757	ELL3_MOUSE RNA polymerase II elongation factor ELL3 OS=Mus musculus OX=10090 GN=Ell3 PE=1 SV=1
2	Q9HB65	0.0	815	397	1.000	1.000	ELL3_HUMAN RNA polymerase II elongation factor ELL3 OS=Homo sapiens OX=9606 GN=ELL3 PE=1 SV=2
3	C9JHD8	4.65e-126	363	206	0.443	0.854	C9JHD8_HUMAN Elongation factor for RNA polymerase II 3 (Fragment) OS=Homo sapiens OX=9606 GN=ELL3 PE=1 SV=1
4	O00472	1.83e-31	128	640	0.159	0.098	ELL2_HUMAN RNA polymerase II elongation factor ELL2 OS=Homo sapiens OX=9606 GN=ELL2 PE=1 SV=2
5	O08856	1.81e-30	125	602	0.141	0.093	ELL_MOUSE RNA polymerase II elongation factor ELL OS=Mus musculus OX=10090 GN=Ell PE=2 SV=2
6	U3KQ90	1.62e-29	121	488	0.131	0.107	U3KQ90_HUMAN Elongation factor for RNA polymerase II OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=2
7	Q6PEG4	2.48e-29	122	633	0.126	0.079	Q6PEG4_DANRE Elongation factor RNA polymerase II OS=Danio rerio OX=7955 GN=wu:fc60b11 PE=1 SV=1
8	P55199	4.52e-29	121	621	0.131	0.084	ELL_HUMAN RNA polymerase II elongation factor ELL OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=1
9	M9YY17	1.36e-14	77.8	569	0.136	0.095	M9YY17_ONCMY Tricellulin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
10	Q9VW51	2.02e-11	68.2	1059	0.093	0.035	ELL_DROME RNA polymerase II elongation factor Ell OS=Drosophila melanogaster OX=7227 GN=Ell PE=1 SV=3
11	A1BQX2	2.18e-11	67.4	442	0.101	0.090	A1BQX2_HUMAN MARVEL domain containing 2 OS=Homo sapiens OX=9606 GN=MARVELD2 PE=1 SV=1
12	Q8N4S9	3.95e-11	67.0	558	0.101	0.072	MALD2_HUMAN MARVEL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MARVELD2 PE=1 SV=2
13	Q3UZP0	1.56e-10	65.1	555	0.098	0.070	MALD2_MOUSE MARVEL domain-containing protein 2 OS=Mus musculus OX=10090 GN=Marveld2 PE=1 SV=1
14	F6RA30	2.20e-08	56.2	206	0.083	0.160	F6RA30_BOVIN Occludin/ELL domain containing 1 OS=Bos taurus OX=9913 GN=OCEL1 PE=3 SV=1
15	Q28269	1.27e-06	52.8	521	0.078	0.060	OCLN_CANLF Occludin OS=Canis lupus familiaris OX=9615 GN=OCLN PE=1 SV=1
16	Q16625	1.29e-05	49.7	522	0.076	0.057	OCLN_HUMAN Occludin OS=Homo sapiens OX=9606 GN=OCLN PE=1 SV=1
17	A2VE81	1.98e-05	48.9	522	0.076	0.057	A2VE81_BOVIN Occludin OS=Bos taurus OX=9913 GN=OCLN PE=2 SV=1
18	Q6PP84	2.06e-05	48.9	449	0.076	0.067	Q6PP84_BOVIN Occludin (Fragment) OS=Bos taurus OX=9913 GN=OCLN PE=2 SV=1
19	Q6P6T5	3.67e-05	48.1	523	0.078	0.059	OCLN_RAT Occludin OS=Rattus norvegicus OX=10116 GN=Ocln PE=1 SV=1
20	Q9PUN1	5.82e-05	47.4	493	0.083	0.067	OCLN_XENLA Occludin OS=Xenopus laevis OX=8355 GN=ocln PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09730 BicD	18	15.0	Microtubule-associated protein Bicaudal-D
2	PF10390 ELL	1.8e-07	42.6	RNA polymerase II elongation factor ELL
3	PF07303 Occludin_ELL	1.1e-25	101.6	Occludin homology domain
4	PF05256 UPF0223	7.7e+02	11.8	Uncharacterised protein family (UPF0223)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320346

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296564	0.943	Little elongation complex subunit 1
2	9606.ENSP00000369695	0.939	Protein AF-9
3	9606.ENSP00000378578	0.917	AF4/FMR2 family member 1
4	9606.ENSP00000265343	0.912	AF4/FMR2 family member 4
5	9606.ENSP00000262809	0.910	RNA polymerase II elongation factor ELL
6	9606.ENSP00000273668	0.902	ELL-associated factor 2
7	9606.ENSP00000252674	0.865	Protein ENL
8	9606.ENSP00000261520	0.864	Little elongation complex subunit 2
9	9606.ENSP00000380054	0.793	ELL-associated factor 1
10	9606.ENSP00000261900	0.773	Cyclin-T1
11	9606.ENSP00000264157	0.762	Cyclin-T2
12	9606.ENSP00000386488	0.691	Zinc finger CCCH domain-containing protein 8
13	9606.ENSP00000269305	0.660	Cellular tumor antigen p53
14	9606.ENSP00000272645	0.658	DNA-directed RNA polymerase II subunit RPB4
15	9606.ENSP00000362361	0.652	Cyclin-dependent kinase 9
16	9606.ENSP00000415433	0.637	Integrator complex subunit 12
17	9606.ENSP00000480158	0.635	DNA-directed RNA polymerase II subunit RPB1
18	9606.ENSP00000403852	0.628	DNA-directed RNA polymerases I, II, and III subunit RPABC2
19	9606.ENSP00000310260	0.622	Integrator complex subunit 6
20	9606.ENSP00000381064	0.617	Integrator complex subunit 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0050794	0.991	regulation of cellular process
GO:0006366	0.991	transcription by RNA polymerase II
GO:0010556	0.976	regulation of macromolecule biosynthetic process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0051252	0.976	regulation of RNA metabolic process
GO:0006355	0.972	regulation of DNA-templated transcription
GO:0048522	0.966	positive regulation of cellular process
GO:0045935	0.954	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.944	positive regulation of DNA-templated transcription
GO:0034660	0.921	ncRNA metabolic process
GO:0016073	0.904	snRNA metabolic process
GO:0045944	0.902	positive regulation of transcription by RNA polymerase II
GO:0006354	0.443	DNA-templated transcription elongation
GO:0098781	0.432	ncRNA transcription
GO:0006368	0.406	transcription elongation by RNA polymerase II
GO:0032784	0.398	regulation of DNA-templated transcription elongation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0032991	0.989	protein-containing complex
GO:0140513	0.974	nuclear protein-containing complex
GO:0005829	0.920	cytosol
GO:0043232	0.912	intracellular non-membrane-bounded organelle
GO:0008023	0.837	transcription elongation factor complex
GO:0016604	0.756	nuclear body
GO:0005694	0.732	chromosome
GO:0005730	0.681	nucleolus
GO:0016607	0.383	nuclear speck
GO:0030054	0.330	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]