StarFunc result for job id Q9HB71

User Input

>input (228 residues)
MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKP
AAVVAPITTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNL
NGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPS
YDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6AYK6	0.692	0.689	9.450E-38	229	0.908	0.904	Q6AYK6.pdb.gz	CYBP_RAT Calcyclin-binding protein OS=Rattus norvegicus OX=10116 GN=Cacybp PE=1 SV=1
2	AFDB:Q9W3Y3	0.500	0.496	8.734E-23	230	0.399	0.396	Q9W3Y3.pdb.gz	Q9W3Y3_DROME Calcyclin-binding protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3226 PE=1 SV=1
3	AFDB:F4I4Q9	0.408	0.406	3.718E-18	229	0.303	0.301	F4I4Q9.pdb.gz	F4I4Q9_ARATH Calcyclin-binding protein OS=Arabidopsis thaliana OX=3702 GN=At1g30070 PE=1 SV=1
4	AFDB:Q9Y2Z0	0.363	0.229	8.607E-11	365	0.206	0.129	Q9Y2Z0.pdb.gz	SGT1_HUMAN Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3
5	AFDB:O59709	0.370	0.226	5.295E-10	379	0.197	0.119	O59709.pdb.gz	GIT7_SCHPO Glucose-insensitive transcription protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=git7 PE=4 SV=2
6	AFDB:C0H473	0.332	0.280	6.747E-10	275	0.206	0.171	C0H473.pdb.gz	C0H473_PLAF7 HSP20-like chaperone, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0314000 PE=3 SV=1
7	AFDB:Q0JL44	0.363	0.230	1.483E-9	367	0.232	0.144	Q0JL44.pdb.gz	SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=SGT1 PE=1 SV=1
8	AFDB:Q9SUR9	0.324	0.215	5.289E-9	350	0.206	0.134	Q9SUR9.pdb.gz	SGT1A_ARATH Protein SGT1 homolog A OS=Arabidopsis thaliana OX=3702 GN=SGT1A PE=1 SV=1
9	AFDB:Q9SUT5	0.360	0.234	9.122E-9	358	0.206	0.131	Q9SUT5.pdb.gz	SGT1B_ARATH Protein SGT1 homolog B OS=Arabidopsis thaliana OX=3702 GN=SGT1B PE=1 SV=1
10	AFDB:A0A1D8PIG5	0.363	0.204	1.887E-8	413	0.154	0.085	A0A1D8PIG5.pdb.gz	A0A1D8PIG5_CANAL Co-chaperone OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SGT1 PE=3 SV=1
11	PDB:7krjC	0.364	0.606	9.135E-7	133	0.070	0.120	7krjC.pdb.gz	Structure of Hsp90-p23-GR reveals the Hsp90 client-remodelling mechanism.
12	PDB:3w1zB	0.287	0.438	2.554E-5	143	0.075	0.119	3w1zB.pdb.gz
13	PDB:2kmwA	0.302	0.437	2.002E-4	150	0.061	0.093	2kmwA.pdb.gz
14	PDB:1shsA	0.293	0.542	5.606E-4	115	0.057	0.113	1shsA.pdb.gz
15	PDB:1gmeA	0.301	0.442	6.328E-4	150	0.061	0.093	1gmeA.pdb.gz
16	PDB:7oa6B	0.308	0.445	3.247E-3	152	0.044	0.066	7oa6B.pdb.gz	Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.
17	PDB:4zjaA	0.248	0.472	3.665E-3	106	0.031	0.066	4zjaA.pdb.gz
18	PDB:6f2rA	0.245	0.399	3.665E-3	130	0.039	0.069	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
19	PDB:4ylbA	0.287	0.486	5.271E-3	128	0.026	0.047	4ylbA.pdb.gz
20	PDB:4ydzA	0.259	0.413	6.715E-3	135	0.057	0.096	4ydzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HB71	4.07e-168	464	228	1.000	1.000	CYBP_HUMAN Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP PE=1 SV=2
2	Q9CXW3	9.52e-147	410	229	0.934	0.930	CYBP_MOUSE Calcyclin-binding protein OS=Mus musculus OX=10090 GN=Cacybp PE=1 SV=1
3	Q6AYK6	9.95e-145	405	229	0.912	0.908	CYBP_RAT Calcyclin-binding protein OS=Rattus norvegicus OX=10116 GN=Cacybp PE=1 SV=1
4	Q9W3Y3	4.31e-48	159	230	0.404	0.400	Q9W3Y3_DROME Calcyclin-binding protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3226 PE=1 SV=1
5	F4I4Q9	6.37e-27	105	229	0.325	0.323	F4I4Q9_ARATH Calcyclin-binding protein OS=Arabidopsis thaliana OX=3702 GN=At1g30070 PE=1 SV=1
6	Q9Y2Z0	2.28e-04	43.9	365	0.202	0.126	SGT1_HUMAN Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3
7	O59709	0.004	40.0	379	0.193	0.116	GIT7_SCHPO Glucose-insensitive transcription protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=git7 PE=4 SV=2
8	Q8SY87	0.051	35.8	178	0.184	0.236	Q8SY87_DROME RH27607p OS=Drosophila melanogaster OX=7227 GN=Sgt1 PE=2 SV=1
9	Q9VHT3	0.10	35.0	178	0.189	0.242	Q9VHT3_DROME CG9617 protein OS=Drosophila melanogaster OX=7227 GN=Sgt1 PE=1 SV=1
10	Q9SUR9	0.14	35.4	350	0.088	0.057	SGT1A_ARATH Protein SGT1 homolog A OS=Arabidopsis thaliana OX=3702 GN=SGT1A PE=1 SV=1
11	Q2XYI8	0.24	33.9	165	0.158	0.218	Q2XYI8_DROME CG9617 (Fragment) OS=Drosophila melanogaster OX=7227 GN=Sgt1 PE=4 SV=1
12	Q9SUT5	0.34	34.3	358	0.088	0.056	SGT1B_ARATH Protein SGT1 homolog B OS=Arabidopsis thaliana OX=3702 GN=SGT1B PE=1 SV=1
13	Q385S8	1.7	32.0	560	0.048	0.020	Q385S8_TRYB2 Guanine nucleotide-binding beta subunit-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2510 PE=4 SV=1
14	Q8WXU2	1.8	32.0	420	0.136	0.074	DAAF4_HUMAN Dynein axonemal assembly factor 4 OS=Homo sapiens OX=9606 GN=DNAAF4 PE=1 SV=2
15	A0A0S2Z5Z4	2.2	31.6	381	0.136	0.081	A0A0S2Z5Z4_HUMAN Dynein axonemal assembly factor 4 (Fragment) OS=Homo sapiens OX=9606 GN=DYX1C1 PE=2 SV=1
16	Q0JL44	2.5	31.6	367	0.154	0.095	SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=SGT1 PE=1 SV=1
17	A4FU91	5.6	30.4	593	0.110	0.042	A4FU91_XENLA Nucleoporin 58kDa L homeolog OS=Xenopus laevis OX=8355 GN=nup58.L PE=2 SV=1
18	Q93789	6.2	30.4	405	0.066	0.037	LIPL1_CAEEL Lipase lipl-1 OS=Caenorhabditis elegans OX=6239 GN=lipl-1 PE=2 SV=2
19	Q7KUA8	9.4	30.0	1985	0.101	0.012	Q7KUA8_DROME Grunge, isoform D OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1
20	Q86BH2	9.4	30.0	1988	0.101	0.012	Q86BH2_DROME Grunge, isoform C OS=Drosophila melanogaster OX=7227 GN=Gug PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04969 CS	1.2e-11	56.8	CS domain
2	PF05002 SGS	0.013	27.0	SGS domain
3	PF09032 Siah-Interact_N	2.8e-25	99.7	Siah interacting protein, N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356652

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.999	S-phase kinase-associated protein 1
2	9606.ENSP00000349156	0.999	E3 ubiquitin-protein ligase SIAH1
3	9606.ENSP00000357709	0.998	Protein S100-A6
4	9606.ENSP00000344456	0.976	Catenin beta-1
5	9606.ENSP00000367208	0.962	Protein SGT1 homolog
6	9606.ENSP00000216479	0.917	Activator of 90 kDa heat shock protein ATPase homolog 1
7	9606.ENSP00000324806	0.915	Glycogen synthase kinase-3 beta
8	9606.ENSP00000262320	0.905	Axin-1
9	9606.ENSP00000222330	0.900	Glycogen synthase kinase-3 alpha
10	9606.ENSP00000257430	0.900	Adenomatous polyposis coli protein
11	9606.ENSP00000291700	0.889	Protein S100-B
12	9606.ENSP00000296370	0.869	Protein S100-P
13	9606.ENSP00000335153	0.869	Heat shock protein HSP 90-alpha
14	9606.ENSP00000351646	0.852	Stress-induced-phosphoprotein 1
15	9606.ENSP00000319664	0.851	Nuclear migration protein nudC
16	9606.ENSP00000377970	0.789	Activator of 90 kDa heat shock protein ATPase homolog 2
17	9606.ENSP00000319255	0.775	Cysteine and histidine-rich domain-containing protein 1
18	9606.ENSP00000361646	0.764	Zinc finger MYND-type containing 12
19	9606.ENSP00000342755	0.761	E3 ubiquitin-protein ligase NRDP1
20	9606.ENSP00000451080	0.739	Enhancer of rudimentary homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.451	identical protein binding
GO:1901363	0.334	heterocyclic compound binding
GO:0097159	0.333	organic cyclic compound binding
GO:0019899	0.318	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0070887	0.984	cellular response to chemical stimulus
GO:0010033	0.959	response to organic substance
GO:0065007	0.919	biological regulation
GO:0050789	0.875	regulation of biological process
GO:0050794	0.814	regulation of cellular process
GO:0032501	0.605	multicellular organismal process
GO:0019222	0.584	regulation of metabolic process
GO:0060255	0.567	regulation of macromolecule metabolic process
GO:0048518	0.566	positive regulation of biological process
GO:0080090	0.557	regulation of primary metabolic process
GO:0051171	0.556	regulation of nitrogen compound metabolic process
GO:0048522	0.440	positive regulation of cellular process
GO:0031323	0.435	regulation of cellular metabolic process
GO:0032502	0.428	developmental process
GO:0010604	0.416	positive regulation of macromolecule metabolic process
GO:0051173	0.414	positive regulation of nitrogen compound metabolic process
GO:0048519	0.403	negative regulation of biological process
GO:0048856	0.400	anatomical structure development
GO:0019219	0.346	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.345	positive regulation of cellular metabolic process
GO:0048523	0.320	negative regulation of cellular process
GO:0007275	0.303	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.996	cytosol
GO:0032991	0.944	protein-containing complex
GO:0140535	0.750	intracellular protein-containing complex
GO:1902494	0.665	catalytic complex
GO:0012505	0.347	endomembrane system
GO:0070062	0.325	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]