StarFunc result for job id Q9HB75

User Input

>input (910 residues)
MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQ
LLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAG
LSGLAHLAHLDLSFNSLETLPACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTH
NRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLR
SLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASP
DAPSSPVAALIPEMPRLFLTSDLDSFPVTPQGCSVTLACGVRLQFPAGATATPITIRYRL
LLPEPGLVPLGPHDALLSHVLELQPHGVAFQQDVGLWLLFTPPQARRCREVVVRTRNDNS
WGDLETYLEEEAPQRLWAHCQVPHFSWFLVVSRPVSNACLVPPEGTLLCSSGHPGVKVIF
PPGATEEPRRVSMQVVRMAGRELQALLGEPEAAVSPLLCLSQSGPPSFLQPVTVQLPLPS
GITGLSLDRSRLHLLYWAPPAATWDDITAQVVLELTHLYARFQVTHFSWYWLWYTTKNCV
GGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRNKVDATLRRLLERYRGPEPSDTV
EMFEGEEFFAAFERGIDVDADRPDCVEGRICFVFYSHLKNVKEVYVTTTLDREAQAVRGQ
VSFYRGAVPVRVPEEAEAARQRKGADALWMATLPIKLPRLRGSEGPRRGAGLSLAPLNLG
DAETGFLTQSNLLSVAGRLGLDWPAVALHLGVSYREVQRIRHEFRDDLDEQIRHMLFSWA
ERQAGQPGAVGLLVQALEQSDRQDVAEEVRAVLELGRRKYQDSIRRMGLAPKDPALPGSS
APQPPEPAQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ERV7	0.660	0.657	0.000	915	0.813	0.809	Q9ERV7.pdb.gz	PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pidd1 PE=1 SV=1
2	AFDB:Q9HB75	1.000	1.000	0.000	910	1.000	1.000	Q9HB75.pdb.gz	PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PIDD1 PE=1 SV=2
3	AFDB:Q3T1J5	0.360	0.371	8.913E-34	880	0.165	0.170	Q3T1J5.pdb.gz	Q3T1J5_RAT Ank3 protein OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=1
4	AFDB:Q5TYL6	0.332	0.334	5.036E-33	905	0.162	0.162	Q5TYL6.pdb.gz	Q5TYL6_CAEEL ZU5 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
5	AFDB:Q0KIE7	0.329	0.203	1.544E-32	1549	0.154	0.090	Q0KIE7.pdb.gz	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
6	AFDB:A0A5F9ZH18	0.334	0.281	1.799E-32	1109	0.157	0.129	A0A5F9ZH18.pdb.gz	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
7	AFDB:P16157	0.339	0.178	1.311E-31	1881	0.154	0.074	P16157.pdb.gz	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
8	AFDB:G5E8K5	0.334	0.172	1.873E-31	1961	0.152	0.070	G5E8K5.pdb.gz	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
9	AFDB:D3Z9Z0	0.332	0.191	1.795E-27	1707	0.136	0.073	D3Z9Z0.pdb.gz	D3Z9Z0_RAT Ankyrin 1 OS=Rattus norvegicus OX=10116 GN=Ank1 PE=1 SV=2
10	AFDB:O70511	0.315	0.127	2.483E-24	2622	0.121	0.042	O70511.pdb.gz	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
11	PDB:7tvfD	0.218	0.376	2.162E-12	515	0.084	0.148	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
12	PDB:7lt9A	0.201	0.670	6.830E-10	251	0.077	0.279	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.
13	PDB:7p5vB	0.205	0.253	5.800E-9	732	0.063	0.078	7p5vB.pdb.gz
14	PDB:6zxdk	0.182	0.356	7.402E-8	430	0.088	0.186	6zxdk.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
15	PDB:5yq5B	0.186	0.492	1.057E-7	306	0.065	0.193	5yq5B.pdb.gz
16	PDB:7ploO	0.173	0.402	1.232E-7	382	0.059	0.141	7ploO.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
17	PDB:5xjxC	0.160	0.336	2.513E-7	365	0.081	0.203	5xjxC.pdb.gz
18	PDB:1xcdA	0.195	0.523	2.783E-7	305	0.063	0.187	1xcdA.pdb.gz
19	PDB:6hkwA	0.186	0.511	1.349E-6	306	0.068	0.203	6hkwA.pdb.gz
20	PDB:6m04A	0.179	0.223	1.494E-6	714	0.060	0.077	6m04A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ERV7	0.0	1389	915	0.814	0.810	PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus OX=10090 GN=Pidd1 PE=1 SV=1
2	Q9HB75	0.0	1808	910	1.000	1.000	PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PIDD1 PE=1 SV=2
3	Q7KRY7	1.15e-24	114	1851	0.081	0.040	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
4	Q96RT1	1.73e-24	113	1412	0.090	0.058	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
5	Q4H4B6	3.24e-24	112	1724	0.082	0.044	SCRIB_DANRE Protein scribble homolog OS=Danio rerio OX=7955 GN=scrib PE=1 SV=1
6	A0A8I6A8N1	3.82e-24	112	1295	0.088	0.062	A0A8I6A8N1_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
7	A0A8I5ZN42	4.21e-24	111	1230	0.088	0.065	A0A8I5ZN42_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
8	O75427	4.33e-24	110	683	0.077	0.102	LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRCH4 PE=1 SV=2
9	A0A8I6ACI5	5.63e-24	111	1364	0.088	0.059	A0A8I6ACI5_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
10	Q921G6	6.41e-24	110	680	0.076	0.101	LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus OX=10090 GN=Lrch4 PE=1 SV=1
11	P70587	6.58e-24	111	1490	0.096	0.058	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
12	A0A8I5ZWX2	7.02e-24	111	1403	0.088	0.057	A0A8I5ZWX2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
13	A0A8I6AE43	7.45e-24	111	1451	0.084	0.052	A0A8I6AE43_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=1
14	M0R9T2	1.62e-23	110	1254	0.066	0.048	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
15	Q80TH2	2.28e-23	109	1402	0.082	0.053	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
16	A0A075B6E9	6.44e-23	108	1495	0.095	0.058	A0A075B6E9_HUMAN Leucine rich repeat containing 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
17	A0A494C1A4	7.74e-23	107	1575	0.095	0.055	A0A494C1A4_HUMAN Leucine rich repeat containing 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
18	Q96NW7	8.56e-23	107	1537	0.095	0.056	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
19	Q5G5E0	1.89e-22	104	526	0.080	0.139	PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana OX=3702 GN=PIRL5 PE=2 SV=1
20	Q66JT1	3.43e-22	105	795	0.095	0.108	LRC8E_MOUSE Volume-regulated anion channel subunit LRRC8E OS=Mus musculus OX=10090 GN=Lrrc8e PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00531 Death	4.9e-11	53.9	Death domain
2	PF13384 HTH_23	4.3e+02	12.2	Homeodomain-like domain
3	PF00560 LRR_1	0.96	21.0	Leucine Rich Repeat
4	PF12799 LRR_4	3.8e-11	54.2	Leucine Rich repeats (2 copies)
5	PF13855 LRR_8	7e-26	101.1	Leucine rich repeat
6	PF14580 LRR_9	19	16.3	Leucine-rich repeat
7	PF10461 Peptidase_S68	5.9e-16	69.8	Peptidase S68
8	PF00791 ZU5	2.6e-14	64.5	ZU5 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337797

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312664	0.999	Caspase-2
2	9606.ENSP00000439068	0.999	Death domain-containing protein CRADD
3	9606.ENSP00000483825	0.976	NF-kappa-B essential modulator
4	9606.ENSP00000259808	0.973	Receptor-interacting serine/threonine-protein kinase 1
5	9606.ENSP00000269305	0.961	Cellular tumor antigen p53
6	9606.ENSP00000341268	0.954	Tumor necrosis factor receptor type 1-associated DEATH domain protein
7	9606.ENSP00000278616	0.950	Serine-protein kinase ATM
8	9606.ENSP00000310933	0.930	MAP kinase-activating death domain protein
9	9606.ENSP00000162749	0.927	Tumor necrosis factor receptor superfamily member 1A
10	9606.ENSP00000263464	0.923	Baculoviral IAP repeat-containing protein 3
11	9606.ENSP00000247668	0.919	TNF receptor-associated factor 2
12	9606.ENSP00000398698	0.917	Tumor necrosis factor
13	9606.ENSP00000318822	0.874	BH3-interacting domain death agonist
14	9606.ENSP00000301838	0.805	FAS-associated death domain protein
15	9606.ENSP00000372023	0.787	Serine/threonine-protein kinase Chk2
16	9606.ENSP00000238628	0.706	Intraflagellar transport proteins
17	9606.ENSP00000318195	0.675	Nucleolin
18	9606.ENSP00000313420	0.650	DNA-dependent protein kinase catalytic subunit
19	9606.ENSP00000448165	0.621	Apoptotic protease-activating factor 1
20	9606.ENSP00000330237	0.585	Caspase-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.981	catalytic activity
GO:0140096	0.955	catalytic activity, acting on a protein
GO:0032813	0.906	tumor necrosis factor receptor superfamily binding
GO:0005123	0.892	death receptor binding
GO:0016787	0.780	hydrolase activity
GO:0008233	0.732	peptidase activity
GO:0004175	0.704	endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0009987	0.988	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.984	cellular response to stimulus
GO:0023052	0.975	signaling
GO:0048518	0.974	positive regulation of biological process
GO:0007165	0.973	signal transduction
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0071704	0.965	organic substance metabolic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0006915	0.964	apoptotic process
GO:0006807	0.938	nitrogen compound metabolic process
GO:0044238	0.927	primary metabolic process
GO:0043170	0.919	macromolecule metabolic process
GO:0031323	0.912	regulation of cellular metabolic process
GO:0048583	0.899	regulation of response to stimulus
GO:1901987	0.891	regulation of cell cycle phase transition
GO:0048519	0.888	negative regulation of biological process
GO:0009966	0.875	regulation of signal transduction
GO:0051247	0.866	positive regulation of protein metabolic process
GO:0097190	0.862	apoptotic signaling pathway
GO:0006919	0.859	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0010948	0.858	negative regulation of cell cycle process
GO:1901990	0.856	regulation of mitotic cell cycle phase transition
GO:1901988	0.853	negative regulation of cell cycle phase transition
GO:0042770	0.835	signal transduction in response to DNA damage
GO:0048522	0.808	positive regulation of cellular process
GO:1903047	0.805	mitotic cell cycle process
GO:0031570	0.805	DNA integrity checkpoint signaling
GO:0045930	0.790	negative regulation of mitotic cell cycle
GO:0010941	0.785	regulation of cell death
GO:1902806	0.785	regulation of cell cycle G1/S phase transition
GO:2000045	0.779	regulation of G1/S transition of mitotic cell cycle
GO:0007093	0.778	mitotic cell cycle checkpoint signaling
GO:1901564	0.774	organonitrogen compound metabolic process
GO:0044774	0.771	mitotic DNA integrity checkpoint signaling
GO:0000077	0.767	DNA damage checkpoint signaling
GO:1901991	0.765	negative regulation of mitotic cell cycle phase transition
GO:0044819	0.741	mitotic G1/S transition checkpoint signaling
GO:0044773	0.740	mitotic DNA damage checkpoint signaling
GO:0043067	0.732	regulation of programmed cell death
GO:0019538	0.696	protein metabolic process
GO:0072331	0.668	signal transduction by p53 class mediator
GO:1902531	0.654	regulation of intracellular signal transduction
GO:0042981	0.650	regulation of apoptotic process
GO:0010468	0.618	regulation of gene expression
GO:0019219	0.602	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.593	regulation of macromolecule biosynthetic process
GO:0031326	0.593	regulation of cellular biosynthetic process
GO:0030330	0.587	DNA damage response, signal transduction by p53 class mediator
GO:0051252	0.584	regulation of RNA metabolic process
GO:0006355	0.566	regulation of DNA-templated transcription
GO:0043065	0.511	positive regulation of apoptotic process
GO:0006508	0.407	proteolysis
GO:0060548	0.403	negative regulation of cell death
GO:0048584	0.358	positive regulation of response to stimulus
GO:0043122	0.346	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0031325	0.342	positive regulation of cellular metabolic process
GO:0009967	0.341	positive regulation of signal transduction
GO:0051090	0.328	regulation of DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.986	intracellular organelle
GO:0005829	0.979	cytosol
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0070013	0.973	intracellular organelle lumen
GO:0005654	0.953	nucleoplasm
GO:0032991	0.898	protein-containing complex
GO:0012505	0.798	endomembrane system
GO:1902494	0.726	catalytic complex
GO:0016020	0.524	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.780	Hydrolases.
EC:3.4.-.-	0.732	Acting on peptide bonds (peptidases).

[back to server]