StarFunc result for job id Q9HB90

User Input

>input (399 residues)
MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGGGCGPGGADSS
KPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ
MDFFDPTFDYEMIFRGTGALIYVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKV
DGLSDDHKIETQRDIHQRANDDLADAGLEKLHLSFYLTSIYDHSIFEAFSKVVQKLIPQL
PTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQSYELCCDMIDVVIDVSCIYG
LKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGLIDYNFHCFR
KAIHEVFEVGVTSHRSCGHQTSASSLKALTHNGTPRNAI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HB90	1.000	1.000	7.409E-76	399	1.000	1.000	Q9HB90.pdb.gz	RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1
2	AFDB:Q9NQL2	0.773	0.771	1.315E-58	400	0.747	0.745	Q9NQL2.pdb.gz	RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens OX=9606 GN=RRAGD PE=1 SV=1
3	AFDB:Q7K519	0.802	0.830	1.139E-54	385	0.644	0.668	Q7K519.pdb.gz	Q7K519_DROME GH16429p OS=Drosophila melanogaster OX=7227 GN=RagC-D PE=1 SV=1
4	PDB:6ulgG	0.759	0.972	9.512E-53	310	0.774	0.997	6ulgG.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
5	AFDB:Q54PK6	0.792	0.877	6.314E-52	360	0.581	0.644	Q54PK6.pdb.gz	Q54PK6_DICDI Ras-related GTP-binding protein OS=Dictyostelium discoideum OX=44689 GN=ragC PE=3 SV=1
6	PDB:6s6dC	0.686	0.955	2.504E-48	284	0.707	0.993	6s6dC.pdb.gz	Architecture of human Rag GTPase heterodimers and their complex with mTORC1.
7	AFDB:O74544	0.752	0.953	6.766E-47	314	0.486	0.618	O74544.pdb.gz	RAGCD_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtr2 PE=3 SV=1
8	AFDB:G5EGB3	0.773	0.911	1.030E-41	338	0.411	0.485	G5EGB3.pdb.gz	G5EGB3_CAEEL Ras-related GTP-binding protein C OS=Caenorhabditis elegans OX=6239 GN=ragc-1 PE=1 SV=1
9	AFDB:P53290	0.755	0.881	1.351E-40	341	0.383	0.449	P53290.pdb.gz	RAGCD_YEAST GTP-binding protein GTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GTR2 PE=1 SV=1
10	AFDB:Q38A82	0.707	0.827	1.462E-30	339	0.316	0.372	Q38A82.pdb.gz	Q38A82_TRYB2 Small GTPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1520 PE=3 SV=1
11	PDB:4arzB	0.558	0.708	7.811E-30	304	0.376	0.493	4arzB.pdb.gz	Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
12	AFDB:O74824	0.649	0.825	5.021E-22	308	0.173	0.224	O74824.pdb.gz	RAGAB_SCHPO GTP-binding protein gtr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtr1 PE=3 SV=1
13	AFDB:Q22743	0.659	0.829	3.264E-21	312	0.165	0.212	Q22743.pdb.gz	Q22743_CAEEL GTP-binding protein OS=Caenorhabditis elegans OX=6239 GN=raga-1 PE=1 SV=1
14	PDB:4arzA	0.607	0.810	5.829E-19	291	0.180	0.247	4arzA.pdb.gz	Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
15	PDB:6cesA	0.639	0.832	2.191E-17	300	0.158	0.210	6cesA.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
16	PDB:6jwpG	0.322	0.638	3.407E-13	197	0.155	0.315	6jwpG.pdb.gz	Structural insights into the EGO-TC-mediated membrane tethering of the TORC1-regulatory Rag GTPases.
17	PDB:6nzdF	0.442	0.716	1.164E-12	227	0.128	0.225	6nzdF.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
18	PDB:1uptG	0.315	0.664	9.306E-8	170	0.088	0.206	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
19	PDB:4zi2A	0.332	0.658	5.076E-7	185	0.080	0.173	4zi2A.pdb.gz	The Interaction of CCDC104/BARTL1 with Arl3 and Implications for Ciliary Function.
20	PDB:4cidA	0.255	0.210	6.414E-7	497	0.083	0.066	4cidA.pdb.gz	Structural Insights Into Membrane Interaction and Caveolar Targeting of Dynamin-Like Ehd2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7K519	0.0	514	385	0.634	0.657	Q7K519_DROME GH16429p OS=Drosophila melanogaster OX=7227 GN=RagC-D PE=1 SV=1
2	Q99K70	0.0	810	398	0.987	0.990	RRAGC_MOUSE Ras-related GTP-binding protein C OS=Mus musculus OX=10090 GN=Rragc PE=1 SV=1
3	Q9HB90	0.0	826	399	1.000	1.000	RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1
4	Q9NQL2	0.0	617	400	0.739	0.738	RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens OX=9606 GN=RRAGD PE=1 SV=1
5	Q54PK6	6.71e-173	488	360	0.586	0.650	Q54PK6_DICDI Ras-related GTP-binding protein OS=Dictyostelium discoideum OX=44689 GN=ragC PE=3 SV=1
6	O74544	9.93e-146	418	314	0.501	0.637	RAGCD_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtr2 PE=3 SV=1
7	G5EGB3	1.85e-109	327	338	0.398	0.470	G5EGB3_CAEEL Ras-related GTP-binding protein C OS=Caenorhabditis elegans OX=6239 GN=ragc-1 PE=1 SV=1
8	P53290	1.33e-100	304	341	0.383	0.449	RAGCD_YEAST GTP-binding protein GTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GTR2 PE=1 SV=1
9	Q38A82	5.51e-69	223	339	0.328	0.386	Q38A82_TRYB2 Small GTPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1520 PE=3 SV=1
10	O74824	5.94e-15	77.0	308	0.158	0.205	RAGAB_SCHPO GTP-binding protein gtr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtr1 PE=3 SV=1
11	Q7ZUI2	8.00e-15	77.0	315	0.150	0.190	Q7ZUI2_DANRE Ras-related GTP-binding protein OS=Danio rerio OX=7955 GN=zgc:56499 PE=1 SV=1
12	Q63486	2.00e-14	75.9	313	0.150	0.192	RRAGA_RAT Ras-related GTP-binding protein A OS=Rattus norvegicus OX=10116 GN=Rraga PE=1 SV=1
13	Q7L523	2.00e-14	75.9	313	0.150	0.192	RRAGA_HUMAN Ras-related GTP-binding protein A OS=Homo sapiens OX=9606 GN=RRAGA PE=1 SV=1
14	Q80X95	2.00e-14	75.9	313	0.150	0.192	RRAGA_MOUSE Ras-related GTP-binding protein A OS=Mus musculus OX=10090 GN=Rraga PE=1 SV=1
15	Q5VZM2	9.67e-14	74.3	374	0.180	0.193	RRAGB_HUMAN Ras-related GTP-binding protein B OS=Homo sapiens OX=9606 GN=RRAGB PE=1 SV=1
16	Q63487	1.27e-13	73.9	374	0.178	0.190	RRAGB_RAT Ras-related GTP-binding protein B OS=Rattus norvegicus OX=10116 GN=RragB PE=1 SV=1
17	Q22743	3.20e-13	72.0	312	0.145	0.186	Q22743_CAEEL GTP-binding protein OS=Caenorhabditis elegans OX=6239 GN=raga-1 PE=1 SV=1
18	Q9VHJ4	1.31e-12	70.5	311	0.148	0.190	Q9VHJ4_DROME GH04846p OS=Drosophila melanogaster OX=7227 GN=RagA-B PE=1 SV=1
19	Q00582	3.89e-11	65.9	310	0.133	0.171	RAGAB_YEAST GTP-binding protein GTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GTR1 PE=1 SV=1
20	A0A1D8PI64	5.82e-10	62.8	352	0.155	0.176	A0A1D8PI64_CANAL GTP-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GTR1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	1.7e+02	13.6	AAA domain
2	PF13191 AAA_16	1.9e+02	13.8	AAA ATPase domain
3	PF00025 Arf	0.03	25.3	ADP-ribosylation factor family
4	PF04670 Gtr1_RagA	3.6e-69	244.3	Gtr1/RagA G protein conserved region
5	PF01926 MMR_HSR1	1e+02	14.4	50S ribosome-binding GTPase
6	PF00071 Ras	19	16.3	Ras family
7	PF08477 Roc	0.17	23.5	Ras of Complex, Roc, domain of DAPkinase
8	PF09439 SRPRB	0.19	22.7	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000016890

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000015731	0.997	Regulatory associated protein of MTOR, complex 1
2	60711.ENSCSAP00000008271	0.995	Ras-related GTP binding B
3	60711.ENSCSAP00000015940	0.994	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
4	60711.ENSCSAP00000017216	0.994	Serine/threonine-protein kinase mTOR
5	60711.ENSCSAP00000013874	0.992	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
6	60711.ENSCSAP00000016461	0.991	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
7	60711.ENSCSAP00000017867	0.991	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
8	60711.ENSCSAP00000004735	0.989	annotation not available
9	60711.ENSCSAP00000012436	0.987	Solute carrier family 38, member 9
10	60711.ENSCSAP00000014837	0.984	Folliculin interacting protein 2
11	60711.ENSCSAP00000010113	0.975	Folliculin interacting protein 1
12	60711.ENSCSAP00000007097	0.966	MTOR associated protein, LST8 homolog (S. cerevisiae)
13	60711.ENSCSAP00000015620	0.959	AKT1 substrate 1 (proline-rich)
14	60711.ENSCSAP00000004829	0.949	DEP domain containing 5
15	60711.ENSCSAP00000000547	0.944	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 1
16	60711.ENSCSAP00000012744	0.931	ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2
17	60711.ENSCSAP00000010329	0.930	Uncharacterized protein
18	60711.ENSCSAP00000003081	0.927	ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A
19	60711.ENSCSAP00000013337	0.927	Ras-related GTP binding D
20	60711.ENSCSAP00000009307	0.926	NPR3 like, GATOR1 complex subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003924	1.000	GTPase activity
GO:0019003	1.000	GDP binding
GO:0005525	1.000	GTP binding
GO:0019899	0.997	enzyme binding
GO:0051020	0.985	GTPase binding
GO:0046983	0.982	protein dimerization activity
GO:0046982	0.957	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0071496	0.995	cellular response to external stimulus
GO:0051716	0.995	cellular response to stimulus
GO:0009991	0.995	response to extracellular stimulus
GO:0009267	0.988	cellular response to starvation
GO:0001101	0.987	response to acid chemical
GO:0034198	0.981	cellular response to amino acid starvation
GO:1902531	0.975	regulation of intracellular signal transduction
GO:0032006	0.968	regulation of TOR signaling
GO:1903432	0.950	regulation of TORC1 signaling
GO:0043200	0.935	response to amino acid
GO:0048518	0.854	positive regulation of biological process
GO:0048522	0.829	positive regulation of cellular process
GO:0023052	0.684	signaling
GO:0007165	0.670	signal transduction
GO:0009967	0.564	positive regulation of signal transduction
GO:0032008	0.526	positive regulation of TOR signaling
GO:0051179	0.326	localization
GO:0048523	0.315	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0000323	0.998	lytic vacuole
GO:0005654	0.997	nucleoplasm
GO:0005764	0.990	lysosome
GO:0032991	0.921	protein-containing complex
GO:0016020	0.857	membrane
GO:0031090	0.742	organelle membrane
GO:0043232	0.703	intracellular non-membrane-bounded organelle
GO:0005774	0.506	vacuolar membrane
GO:0098852	0.504	lytic vacuole membrane
GO:0005765	0.352	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	1.000	GTP + H2O = GDP + H(+) + phosphate

[back to server]