StarFunc result for job id Q9HBA0

User Input

>input (871 residues)
MADSSEGPRAGPGEVAELPGDESGTPGGEAFPLSSLANLFEGEDGSLSPSPADASRPAGP
GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHSSDN
KRWRKKIIEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLPFLLTHKKRL
TDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQT
ALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI
VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCARLFPDS
NLEAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEASVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLC
AMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEVITLFTGVLFFFTNIKDLFMKKCPGV
NSLFIDGSFQLLYFIYSVLVIVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTG
TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCANMKVCNEDQTNCTVPTYPSC
RDSETFSTFLLDLFKLTIGMGDLEMLSSTKYPVVFIILLVTYIILTFVLLLNMLIALMGE
TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV
DEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDE
VVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2KN54	0.790	0.790	0.000	871	0.974	0.974	B2KN54.pdb.gz	B2KN54_CANLF TRPV4 OS=Canis lupus familiaris OX=9615 GN=LOC100856786 PE=2 SV=1
2	AFDB:F1RIT1	0.792	0.835	2.257E-102	824	0.916	0.968	F1RIT1.pdb.gz	F1RIT1_PIG Transient receptor potential cation channel subfamily V member 4 OS=Sus scrofa OX=9823 GN=TRPV4 PE=4 SV=4
3	AFDB:A0A6I8RQZ3	0.819	0.821	8.373E-99	868	0.778	0.781	A0A6I8RQZ3.pdb.gz	A0A6I8RQZ3_XENTR Transient receptor potential cation channel subfamily V member 4 OS=Xenopus tropicalis OX=8364 GN=trpv4 PE=1 SV=1
4	PDB:7aa5A	0.651	0.913	1.682E-65	612	0.701	0.998	7aa5A.pdb.gz
5	AFDB:Q8NER1	0.711	0.737	5.417E-65	839	0.421	0.437	Q8NER1.pdb.gz	TRPV1_HUMAN Transient receptor potential cation channel subfamily V member 1 OS=Homo sapiens OX=9606 GN=TRPV1 PE=1 SV=2
6	AFDB:Q704Y3	0.712	0.737	6.477E-65	839	0.423	0.439	Q704Y3.pdb.gz	TRPV1_MOUSE Transient receptor potential cation channel subfamily V member 1 OS=Mus musculus OX=10090 GN=Trpv1 PE=1 SV=1
7	AFDB:A0A1J0M1I2	0.693	0.735	9.549E-59	819	0.378	0.402	A0A1J0M1I2.pdb.gz
8	PDB:7lp9A	0.689	0.938	4.116E-56	634	0.387	0.532	7lp9A.pdb.gz	Heat-dependent opening of TRPV1 in the presence of capsaicin.
9	AFDB:G1SNM3	0.727	0.772	5.933E-56	817	0.392	0.417	G1SNM3.pdb.gz	G1SNM3_RABIT Transient receptor potential cation channel subfamily V member 2 OS=Oryctolagus cuniculus OX=9986 GN=TRPV2 PE=1 SV=2
10	AFDB:Q9Y5S1	0.718	0.815	1.895E-55	764	0.373	0.425	Q9Y5S1.pdb.gz	TRPV2_HUMAN Transient receptor potential cation channel subfamily V member 2 OS=Homo sapiens OX=9606 GN=TRPV2 PE=1 SV=1
11	AFDB:Q9WUD2	0.727	0.828	2.266E-55	761	0.375	0.430	Q9WUD2.pdb.gz	TRPV2_RAT Transient receptor potential cation channel subfamily V member 2 OS=Rattus norvegicus OX=10116 GN=Trpv2 PE=1 SV=2
12	AFDB:Q5EA32	0.680	0.780	6.458E-54	753	0.373	0.432	Q5EA32.pdb.gz	Q5EA32_BOVIN Transient receptor potential cation channel subfamily V member 2 OS=Bos taurus OX=9913 GN=TRPV2 PE=1 SV=1
13	PDB:6bwjB	0.657	0.911	1.033E-47	617	0.349	0.493	6bwjB.pdb.gz	Conformational plasticity in the selectivity filter of the TRPV2 ion channel.
14	PDB:6u84A	0.648	0.880	8.811E-47	630	0.341	0.471	6u84A.pdb.gz
15	PDB:6mhvA	0.633	0.883	2.049E-44	613	0.328	0.467	6mhvA.pdb.gz
16	PDB:6pvpA	0.648	0.842	3.097E-39	661	0.331	0.436	6pvpA.pdb.gz
17	PDB:6uw9A	0.600	0.882	3.455E-38	582	0.318	0.476	6uw9A.pdb.gz
18	PDB:6pvqA	0.544	0.825	1.984E-30	562	0.261	0.404	6pvqA.pdb.gz
19	PDB:6e2fC	0.570	0.754	8.800E-27	647	0.218	0.294	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.
20	PDB:6dmwA	0.559	0.756	5.024E-26	631	0.222	0.306	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6I8RQZ3	0.0	1416	868	0.782	0.785	A0A6I8RQZ3_XENTR Transient receptor potential cation channel subfamily V member 4 OS=Xenopus tropicalis OX=8364 GN=trpv4 PE=1 SV=1
2	B0S711	0.0	620	813	0.382	0.410	B0S711_DANRE Transient receptor potential cation channel subfamily V member 1 OS=Danio rerio OX=7955 GN=si:dkey-9e15.2 PE=4 SV=1
3	B2KN54	0.0	1762	871	0.975	0.975	B2KN54_CANLF TRPV4 OS=Canis lupus familiaris OX=9615 GN=LOC100856786 PE=2 SV=1
4	B3VP30	0.0	1750	871	0.970	0.970	B3VP30_PIG Transient receptor potential cation channel subfamily V member 4 OS=Sus scrofa OX=9823 GN=TRPV4 PE=2 SV=1
5	B6RTA2	0.0	619	819	0.382	0.407	B6RTA2_DANRE Transient receptor potential cation channel subfamily V member 1 OS=Danio rerio OX=7955 GN=TRPV1 PE=2 SV=1
6	E9PU00	0.0	548	791	0.346	0.381	E9PU00_RAT Transient receptor potential cation channel, subfamily V, member 3 OS=Rattus norvegicus OX=10116 GN=Trpv3 PE=4 SV=1
7	F1RIT1	0.0	1622	823	0.915	0.968	F1RIT1_PIG Transient receptor potential cation channel subfamily V member 4 OS=Sus scrofa OX=9823 GN=TRPV4 PE=4 SV=4
8	O35433	0.0	712	838	0.411	0.427	TRPV1_RAT Transient receptor potential cation channel subfamily V member 1 OS=Rattus norvegicus OX=10116 GN=Trpv1 PE=1 SV=1
9	Q0PEH1	0.0	1209	841	0.691	0.716	Q0PEH1_DANRE Transient receptor potential cation channel subfamily V member 4 OS=Danio rerio OX=7955 GN=wu:fp52e02 PE=2 SV=1
10	Q704Y3	0.0	710	839	0.414	0.430	TRPV1_MOUSE Transient receptor potential cation channel subfamily V member 1 OS=Mus musculus OX=10090 GN=Trpv1 PE=1 SV=1
11	Q8K424	0.0	548	791	0.375	0.413	TRPV3_MOUSE Transient receptor potential cation channel subfamily V member 3 OS=Mus musculus OX=10090 GN=Trpv3 PE=1 SV=2
12	Q8NER1	0.0	706	839	0.409	0.424	TRPV1_HUMAN Transient receptor potential cation channel subfamily V member 1 OS=Homo sapiens OX=9606 GN=TRPV1 PE=1 SV=2
13	Q9EPK8	0.0	1705	871	0.953	0.953	TRPV4_MOUSE Transient receptor potential cation channel subfamily V member 4 OS=Mus musculus OX=10090 GN=Trpv4 PE=1 SV=1
14	Q9ERZ8	0.0	1699	871	0.948	0.948	TRPV4_RAT Transient receptor potential cation channel subfamily V member 4 OS=Rattus norvegicus OX=10116 GN=Trpv4 PE=1 SV=1
15	Q9HBA0	0.0	1805	871	1.000	1.000	TRPV4_HUMAN Transient receptor potential cation channel subfamily V member 4 OS=Homo sapiens OX=9606 GN=TRPV4 PE=1 SV=2
16	Q9Y5S1	0.0	546	764	0.364	0.415	TRPV2_HUMAN Transient receptor potential cation channel subfamily V member 2 OS=Homo sapiens OX=9606 GN=TRPV2 PE=1 SV=1
17	Q9Z182	0.0	662	528	0.369	0.608	Q9Z182_RAT Stretch-inhibitable nonselective channel (SIC) OS=Rattus norvegicus OX=10116 PE=2 SV=2
18	Q2M3L1	4.51e-177	533	791	0.335	0.369	Q2M3L1_HUMAN TRPV3 protein OS=Homo sapiens OX=9606 GN=TRPV3 PE=1 SV=1
19	Q8NET8	9.80e-177	532	790	0.335	0.370	TRPV3_HUMAN Transient receptor potential cation channel subfamily V member 3 OS=Homo sapiens OX=9606 GN=TRPV3 PE=1 SV=2
20	G1SNM3	4.01e-175	528	817	0.357	0.381	G1SNM3_RABIT Transient receptor potential cation channel subfamily V member 2 OS=Oryctolagus cuniculus OX=9986 GN=TRPV2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.4e-05	36.5	Ankyrin repeat
2	PF12796 Ank_2	2.2e-09	49.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	4.4e-05	34.4	Ankyrin repeat
4	PF13637 Ank_4	0.00093	31.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.031	25.8	Ankyrin repeats (many copies)
6	PF00520 Ion_trans	4.9e-11	53.9	Ion transport protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406191

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419313	0.993	Short transient receptor potential channel 1
2	9606.ENSP00000237596	0.991	Polycystin-2
3	9606.ENSP00000372654	0.991	Aquaporin-4
4	9606.ENSP00000362680	0.949	Proto-oncogene tyrosine-protein kinase Src
5	9606.ENSP00000482335	0.942	Ensconsin
6	9606.ENSP00000199280	0.938	Aquaporin-2
7	9606.ENSP00000340913	0.936	Short transient receptor potential channel 6
8	9606.ENSP00000323926	0.922	Transient receptor potential cation channel subfamily M member 8
9	9606.ENSP00000344456	0.919	Catenin beta-1
10	9606.ENSP00000440945	0.918	Protein kinase C and casein kinase substrate in neurons protein 3
11	9606.ENSP00000481848	0.885	Small conductance calcium-activated potassium channel protein 3
12	9606.ENSP00000339191	0.881	Caveolin-1
13	9606.ENSP00000293599	0.875	Aquaporin-5
14	9606.ENSP00000368966	0.861	Short transient receptor potential channel 3
15	9606.ENSP00000347454	0.840	Anoctamin-1
16	9606.ENSP00000408695	0.840	Protein kinase C alpha type
17	9606.ENSP00000378207	0.831	A-kinase anchor protein 5
18	9606.ENSP00000306124	0.829	Protein kinase C epsilon type
19	9606.ENSP00000378217	0.809	Protein kinase C delta type
20	9606.ENSP00000263431	0.806	Protein kinase C gamma type

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005262	1.000	calcium channel activity
GO:0042802	0.831	identical protein binding
GO:0022839	0.648	monoatomic ion gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0006970	0.991	response to osmotic stress
GO:0006810	0.990	transport
GO:0065007	0.988	biological regulation
GO:0003013	0.987	circulatory system process
GO:0051716	0.984	cellular response to stimulus
GO:0050794	0.979	regulation of cellular process
GO:0006971	0.978	hypotonic response
GO:0006816	0.970	calcium ion transport
GO:0055085	0.968	transmembrane transport
GO:0042592	0.957	homeostatic process
GO:0071840	0.956	cellular component organization or biogenesis
GO:0065008	0.956	regulation of biological quality
GO:0034220	0.946	monoatomic ion transmembrane transport
GO:0098662	0.945	inorganic cation transmembrane transport
GO:0003018	0.943	vascular process in circulatory system
GO:0042221	0.941	response to chemical
GO:0016043	0.929	cellular component organization
GO:0048519	0.925	negative regulation of biological process
GO:0070588	0.925	calcium ion transmembrane transport
GO:0043114	0.890	regulation of vascular permeability
GO:0048518	0.861	positive regulation of biological process
GO:0051050	0.782	positive regulation of transport
GO:0051239	0.748	regulation of multicellular organismal process
GO:0048522	0.748	positive regulation of cellular process
GO:0033554	0.746	cellular response to stress
GO:0070887	0.745	cellular response to chemical stimulus
GO:0006884	0.731	cell volume homeostasis
GO:0071470	0.730	cellular response to osmotic stress
GO:0007204	0.605	positive regulation of cytosolic calcium ion concentration
GO:0007154	0.538	cell communication
GO:0048871	0.527	multicellular organismal-level homeostasis
GO:0019222	0.508	regulation of metabolic process
GO:0060255	0.486	regulation of macromolecule metabolic process
GO:0023052	0.460	signaling
GO:0007165	0.403	signal transduction
GO:0048856	0.361	anatomical structure development
GO:0080090	0.324	regulation of primary metabolic process
GO:0031323	0.324	regulation of cellular metabolic process
GO:0048523	0.319	negative regulation of cellular process
GO:0051171	0.314	regulation of nitrogen compound metabolic process
GO:0048878	0.304	chemical homeostasis
GO:0006937	0.302	regulation of muscle contraction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.923	organelle
GO:0043227	0.900	membrane-bounded organelle
GO:0005622	0.808	intracellular anatomical structure
GO:0120025	0.736	plasma membrane bounded cell projection
GO:0043229	0.729	intracellular organelle
GO:0005737	0.722	cytoplasm
GO:0043231	0.719	intracellular membrane-bounded organelle
GO:0098590	0.478	plasma membrane region
GO:0005929	0.304	cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]