StarFunc result for job id Q9HBD1

User Input

>input (1191 residues)
MPVQAAQWTEFLSCPICYNEFDENVHKPISLGCSHTVCKTCLNKLHRKACPFDQTAINTD
IDVLPVNFALLQLVGAQVPDHQSIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGVAS
LNQSALSRPMQRKLVTLVNCQLVEEEGRVRAMRAARSLGERTVTELILQHQNPQQLSANL
WAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIG
HVVQLLYRASCFKVTKRDEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLRISPEQW
SSLLYGDLAHKSHMQSIIDKLQSPESFAKSVQELTIVLQRTGDPANLNRLRPHLELLANI
DPNPDAVSPTWEQLENAMVAVKTVVHGLVDFIQNYSRKGHETPQPQPNSKYKTSMCRDLR
QQGGCPRGTNCTFAHSQEELEKYRLRNKKINATVRTFPLLNKVGVNNTVTTTAGNVISVI
GSTETTGKIVPSTNGISNAENSVSQLISRSTDSTLRALETVKKVGKVGANGQNAAGPSAD
SVTENKIGSPPKTPVSNVAATSAGPSNVGTELNSVPQKSSPFLTRVPVYPPHSENIQYFQ
DPRTQIPFEVPQYPQTGYYPPPPTVPAGVAPCVPRFVRSNNVPESSLPPASMPYADHYST
FSPRDRMNSSPYQPPPPQPYGPVPPVPSGMYAPVYDSRRIWRPPMYQRDDIIRSNSLPPM
DVMHSSVYQTSLRERYNSLDGYYSVACQPPSEPRTTVPLPREPCGHLKTSCEEQIRRKPD
QWAQYHTQKAPLVSSTLPVATQSPTPPSPLFSVDFRADFSESVSGTKFEEDHLSHYSPWS
CGTIGSCINAIDSEPKDVIANSNAVLMDLDSGDVKRRVHLFETQRRTKEEDPIIPFSDGP
IISKWGAISRSSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATS
SAHYVERDRFIVTDLSGHRKHSSTGDLLSLELQQAKSNSLLLQREANALAMQQKWNSLDE
GRHLTLNLLSKEIELRNGELQSDYTEDATDTKPDRDIELELSALDTDEPDGQSEPIEEIL
DIQLGISSQNDQLLNGMAVENGHPVQQHQKEPPKQKKQSLGEDHVILEEQKTILPVTSCF
SQPLPVSISNASCLPITTSVSAGNLILKTHVMSEDKNDFLKPVANGKMVNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R899	0.390	0.390	0.000	1191	1.000	1.000	A0A024R899.pdb.gz
2	AFDB:Q5TC82	0.397	0.416	1.022E-72	1133	0.485	0.510	Q5TC82.pdb.gz	RC3H1_HUMAN Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1
3	AFDB:Q9VV48	0.325	0.471	3.812E-51	819	0.297	0.432	Q9VV48.pdb.gz	Q9VV48_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=roq PE=1 SV=1
4	AFDB:P78312	0.053	0.050	1.922E-3	1265	0.138	0.130	P78312.pdb.gz	F193A_HUMAN Protein FAM193A OS=Homo sapiens OX=9606 GN=FAM193A PE=1 SV=2
5	AFDB:O96433	0.045	0.048	2.627E-3	1097	0.118	0.129	O96433.pdb.gz	CCNT_DROME Cyclin-T OS=Drosophila melanogaster OX=7227 GN=CycT PE=1 SV=2
6	AFDB:A0A0B4K822	0.045	0.045	9.596E-3	1136	0.138	0.144	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
7	AFDB:D3Z8E6	0.066	0.055	1.255E-2	1604	0.123	0.092	D3Z8E6.pdb.gz	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
8	AFDB:Q6AWQ1	0.064	0.073	1.255E-2	954	0.115	0.144	Q6AWQ1.pdb.gz	Q6AWQ1_DROME RE71183p OS=Drosophila melanogaster OX=7227 GN=Srrm1 PE=2 SV=1
9	AFDB:Q9CXB8	0.072	0.070	1.640E-2	1231	0.107	0.103	Q9CXB8.pdb.gz	ALPK1_MOUSE Alpha-protein kinase 1 OS=Mus musculus OX=10090 GN=Alpk1 PE=2 SV=2
10	AFDB:Q3ULZ2	0.060	0.061	1.793E-2	1149	0.125	0.130	Q3ULZ2.pdb.gz	FHDC1_MOUSE FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhdc1 PE=1 SV=3
11	PDB:7f1qR	0.064	0.129	8.882E-2	367	0.039	0.125	7f1qR.pdb.gz
12	PDB:3euhB	0.075	0.206	1.062E-1	321	0.037	0.137	3euhB.pdb.gz
13	PDB:2nyxB	0.060	0.358	1.452E-1	147	0.018	0.143	2nyxB.pdb.gz
14	PDB:5afqB	0.067	0.154	1.518E-1	444	0.034	0.090	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
15	PDB:3zqeA	0.050	0.114	2.170E-1	272	0.024	0.107	3zqeA.pdb.gz	Crystal Structure of Prgi-Sipd: Insight Into a Secretion Competent State of the Type Three Secretion System Needle Tip and its Interaction with Host Ligands
16	PDB:4zzlA	0.060	0.312	2.269E-1	146	0.020	0.164	4zzlA.pdb.gz
17	PDB:6wwzR	0.054	0.140	2.269E-1	310	0.030	0.116	6wwzR.pdb.gz
18	PDB:6xhiA	0.053	0.094	2.481E-1	473	0.039	0.099	6xhiA.pdb.gz	Structural analysis of the Sulfolobus solfataricus TF55beta chaperonin by cryo-electron microscopy
19	PDB:7mexA	0.077	0.063	2.595E-1	1737	0.038	0.026	7mexA.pdb.gz	Structural insights into Ubr1-mediated N-degron polyubiquitination.
20	PDB:4b2te	0.050	0.101	2.967E-1	359	0.036	0.120	4b2te.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C090	0.0	2310	1187	0.953	0.956	RC3H2_MOUSE Roquin-2 OS=Mus musculus OX=10090 GN=Rc3h2 PE=1 SV=1
2	Q4VGL6	0.0	1006	1130	0.497	0.524	RC3H1_MOUSE Roquin-1 OS=Mus musculus OX=10090 GN=Rc3h1 PE=1 SV=1
3	Q5TC82	0.0	1005	1133	0.494	0.519	RC3H1_HUMAN Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1
4	Q9HBD1	0.0	2467	1191	1.000	1.000	RC3H2_HUMAN Roquin-2 OS=Homo sapiens OX=9606 GN=RC3H2 PE=1 SV=2
5	Q9VV48	0.0	592	819	0.256	0.372	Q9VV48_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=roq PE=1 SV=1
6	O45962	6.40e-91	316	952	0.140	0.175	RLE1_CAEEL Regulation of longevity by E3 ubiquitin-protein ligase OS=Caenorhabditis elegans OX=6239 GN=rle-1 PE=1 SV=4
7	G5ED20	8.15e-07	55.8	944	0.016	0.020	G5ED20_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tam-1 PE=1 SV=1
8	O01481	1.88e-04	47.0	283	0.017	0.071	O01481_CAEEL RING-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C06A5.8 PE=1 SV=1
9	Q498M5	2.16e-04	48.1	735	0.019	0.031	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
10	Q8TEC5	2.75e-04	47.8	729	0.018	0.029	SH3R2_HUMAN E3 ubiquitin-protein ligase SH3RF2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=3
11	Q08AM8	2.82e-04	47.8	729	0.018	0.029	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
12	Q13049	4.89e-04	46.6	653	0.021	0.038	TRI32_HUMAN E3 ubiquitin-protein ligase TRIM32 OS=Homo sapiens OX=9606 GN=TRIM32 PE=1 SV=2
13	Q8CH72	5.61e-04	46.6	655	0.021	0.038	TRI32_MOUSE E3 ubiquitin-protein ligase TRIM32 OS=Mus musculus OX=10090 GN=Trim32 PE=1 SV=2
14	Q94131	6.15e-04	45.8	335	0.015	0.054	PIE1_CAEEL Pharynx and intestine in excess protein 1 OS=Caenorhabditis elegans OX=6239 GN=pie-1 PE=1 SV=1
15	Q922Y2	6.65e-04	45.8	403	0.027	0.079	TRI59_MOUSE Tripartite motif-containing protein 59 OS=Mus musculus OX=10090 GN=Trim59 PE=1 SV=2
16	O17099	6.77e-04	45.8	374	0.022	0.070	O17099_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F42G2.5 PE=1 SV=1
17	P47980	7.94e-04	45.8	436	0.018	0.048	TIS11_DROME Protein TIS11 OS=Drosophila melanogaster OX=7227 GN=Tis11 PE=2 SV=2
18	Q69ZI1	0.001	45.4	892	0.020	0.027	SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus OX=10090 GN=Sh3rf1 PE=1 SV=2
19	A0A0R4IL45	0.002	44.7	663	0.024	0.042	A0A0R4IL45_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim32 PE=3 SV=1
20	Q71F54	0.002	45.1	894	0.018	0.025	SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus OX=10116 GN=Sh3rf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	0.42	21.8	Prokaryotic RING finger family 4
2	PF18386 ROQ_II	2.3e-31	118.7	Roquin II domain
3	PF08043 Xin	1.7e+02	13.2	Xin repeat
4	PF00097 zf-C3HC4	24	16.2	Zinc finger, C3HC4 type (RING finger)
5	PF13923 zf-C3HC4_2	5.1e+02	11.9	Zinc finger, C3HC4 type (RING finger)
6	PF13920 zf-C3HC4_3	0.32	22.2	Zinc finger, C3HC4 type (RING finger)
7	PF15227 zf-C3HC4_4	28	16.2	zinc finger of C3HC4-type, RING
8	PF00642 zf-CCCH	0.0074	27.4	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
9	PF18044 zf-CCCH_4	3.3	18.9	CCCH-type zinc finger
10	PF16685 zf-RING_10	2.2e+02	13.4	zinc RING finger of MSL2
11	PF13639 zf-RING_2	0.022	26.4	Ring finger domain
12	PF14634 zf-RING_5	0.019	26.3	zinc-RING finger domain
13	PF13445 zf-RING_UBOX	0.052	24.9	RING-type zinc-finger
14	PF18345 zf_CCCH_4	6.5	18.2	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362774

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356669	0.847	Roquin-1
2	9606.ENSP00000351524	0.845	Probable helicase with zinc finger domain
3	9606.ENSP00000290650	0.836	E3 ubiquitin-protein ligase UBR1
4	9606.ENSP00000341342	0.792	Kelch-like protein 6
5	9606.ENSP00000275034	0.748	PH-interacting protein
6	9606.ENSP00000225388	0.738	Nuclear fragile X mental retardation-interacting protein 2
7	9606.ENSP00000356579	0.727	Centrosome-associated protein 350
8	9606.ENSP00000264951	0.710	5'-3' exoribonuclease 1
9	9606.ENSP00000220592	0.700	Protein argonaute-2
10	9606.ENSP00000362751	0.683	Rab GTPase-activating protein 1
11	9606.ENSP00000478783	0.680	E3 ubiquitin-protein ligase listerin
12	9606.ENSP00000229195	0.676	CCR4-NOT transcription complex subunit 2
13	9606.ENSP00000355279	0.676	CCR4-NOT transcription complex subunit 7
14	9606.ENSP00000362179	0.676	Endoribonuclease ZC3H12A
15	9606.ENSP00000273064	0.661	CCR4-NOT transcription complex subunit 9
16	9606.ENSP00000366843	0.659	Ataxin-2
17	9606.ENSP00000277165	0.655	Constitutive coactivator of PPAR-gamma-like protein 1
18	9606.ENSP00000265343	0.654	AF4/FMR2 family member 4
19	9606.ENSP00000380888	0.648	Mediator of RNA polymerase II transcription subunit 13
20	9606.ENSP00000380659	0.641	Eukaryotic translation initiation factor 4E transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0004842	0.998	ubiquitin-protein transferase activity
GO:0035613	0.994	RNA stem-loop binding
GO:0061630	0.994	ubiquitin protein ligase activity
GO:0003725	0.941	double-stranded RNA binding
GO:0003729	0.848	mRNA binding
GO:0044877	0.801	protein-containing complex binding
GO:1905762	0.562	CCR4-NOT complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.977	regulation of biological process
GO:0071704	0.976	organic substance metabolic process
GO:0044238	0.975	primary metabolic process
GO:0050794	0.972	regulation of cellular process
GO:0009987	0.965	cellular process
GO:0006807	0.965	nitrogen compound metabolic process
GO:0048522	0.956	positive regulation of cellular process
GO:0043170	0.948	macromolecule metabolic process
GO:0048519	0.944	negative regulation of biological process
GO:0002682	0.939	regulation of immune system process
GO:0051171	0.935	regulation of nitrogen compound metabolic process
GO:0080090	0.930	regulation of primary metabolic process
GO:0048523	0.930	negative regulation of cellular process
GO:0019219	0.915	regulation of nucleobase-containing compound metabolic process
GO:0051249	0.912	regulation of lymphocyte activation
GO:0050896	0.908	response to stimulus
GO:0010608	0.890	post-transcriptional regulation of gene expression
GO:0048583	0.887	regulation of response to stimulus
GO:0051252	0.875	regulation of RNA metabolic process
GO:0051716	0.847	cellular response to stimulus
GO:1903706	0.839	regulation of hemopoiesis
GO:0019538	0.826	protein metabolic process
GO:0050863	0.792	regulation of T cell activation
GO:0002757	0.791	immune response-activating signaling pathway
GO:0002683	0.787	negative regulation of immune system process
GO:0046636	0.781	negative regulation of alpha-beta T cell activation
GO:0050851	0.778	antigen receptor-mediated signaling pathway
GO:0002819	0.776	regulation of adaptive immune response
GO:0070647	0.768	protein modification by small protein conjugation or removal
GO:0000209	0.753	protein polyubiquitination
GO:0032501	0.743	multicellular organismal process
GO:0045580	0.742	regulation of T cell differentiation
GO:0044237	0.741	cellular metabolic process
GO:0032502	0.740	developmental process
GO:0048856	0.716	anatomical structure development
GO:0045581	0.701	negative regulation of T cell differentiation
GO:0046649	0.698	lymphocyte activation
GO:2000514	0.698	regulation of CD4-positive, alpha-beta T cell activation
GO:0046637	0.696	regulation of alpha-beta T cell differentiation
GO:0031326	0.678	regulation of cellular biosynthetic process
GO:0010605	0.677	negative regulation of macromolecule metabolic process
GO:0010556	0.671	regulation of macromolecule biosynthetic process
GO:0034641	0.620	cellular nitrogen compound metabolic process
GO:1901360	0.586	organic cyclic compound metabolic process
GO:0051246	0.586	regulation of protein metabolic process
GO:0046483	0.566	heterocycle metabolic process
GO:0090304	0.562	nucleic acid metabolic process
GO:0016070	0.517	RNA metabolic process
GO:1903311	0.434	regulation of mRNA metabolic process
GO:0009966	0.433	regulation of signal transduction
GO:0009893	0.407	positive regulation of metabolic process
GO:0009894	0.403	regulation of catabolic process
GO:0006417	0.402	regulation of translation
GO:0010604	0.376	positive regulation of macromolecule metabolic process
GO:0010629	0.373	negative regulation of gene expression
GO:0031325	0.368	positive regulation of cellular metabolic process
GO:0031329	0.367	regulation of cellular catabolic process
GO:0051172	0.363	negative regulation of nitrogen compound metabolic process
GO:0051173	0.358	positive regulation of nitrogen compound metabolic process
GO:0050852	0.344	T cell receptor signaling pathway
GO:0007275	0.342	multicellular organism development
GO:0042110	0.338	T cell activation
GO:1903131	0.320	mononuclear cell differentiation
GO:0044260	0.312	cellular macromolecule metabolic process
GO:0046631	0.312	alpha-beta T cell activation
GO:0030098	0.304	lymphocyte differentiation
GO:0048731	0.303	system development
GO:0065008	0.301	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0005737	0.936	cytoplasm
GO:0043232	0.882	intracellular non-membrane-bounded organelle
GO:0005634	0.780	nucleus
GO:0070013	0.571	intracellular organelle lumen
GO:0035770	0.567	ribonucleoprotein granule
GO:0036464	0.553	cytoplasmic ribonucleoprotein granule
GO:0005829	0.548	cytosol
GO:0032991	0.514	protein-containing complex
GO:0031981	0.323	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]