StarFunc result for job id Q9HBE1

User Input

>input (687 residues)
MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPADVGGATAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAIAGQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPSVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPILNGGAAFH
CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSANGSFSCDMAVPKNKMESD
GEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFG
FQIVQSAFASSLVDPEVDQQPMGPEGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1M5	0.352	0.352	3.193E-101	687	1.000	1.000	A0A024R1M5.pdb.gz
2	AFDB:A0A024R1F8	0.274	0.290	3.916E-93	641	0.933	1.000	A0A024R1F8.pdb.gz
3	AFDB:Q6ZSB9	0.156	0.145	1.100E-20	765	0.231	0.208	Q6ZSB9.pdb.gz	ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens OX=9606 GN=ZBTB49 PE=1 SV=3
4	AFDB:Q61967	0.222	0.237	4.331E-16	636	0.164	0.178	Q61967.pdb.gz	ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus OX=10090 GN=Zfp90 PE=1 SV=1
5	AFDB:Q86WZ6	0.177	0.156	1.403E-15	799	0.156	0.134	Q86WZ6.pdb.gz	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
6	AFDB:Q9W3J9	0.161	0.182	1.588E-15	598	0.137	0.157	Q9W3J9.pdb.gz	Q9W3J9_DROME LP13385p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2116 PE=2 SV=1
7	AFDB:Q9EQJ4	0.171	0.197	2.164E-15	579	0.157	0.187	Q9EQJ4.pdb.gz	ZN384_RAT Zinc finger protein 384 OS=Rattus norvegicus OX=10116 GN=Znf384 PE=1 SV=1
8	AFDB:P10074	0.157	0.157	2.302E-15	688	0.230	0.230	P10074.pdb.gz	TZAP_HUMAN Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2
9	AFDB:O88412	0.196	0.249	5.474E-15	524	0.164	0.216	O88412.pdb.gz	O88412_MOUSE Zinc finger protein 105 OS=Mus musculus OX=10090 GN=Zfp105 PE=2 SV=1
10	AFDB:F1RAC1	0.144	0.097	8.442E-15	1146	0.201	0.120	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
11	PDB:3w5kB	0.074	0.276	3.332E-4	110	0.045	0.282	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:1b8tA	0.047	0.120	6.327E-1	192	0.048	0.172	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:7dvqM	0.043	0.106	9.172E-1	191	0.039	0.141	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:5gm6a	0.030	0.109	1.414	123	0.025	0.138	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:6ydhA	0.026	0.229	1.703	62	0.013	0.145	6ydhA.pdb.gz
16	PDB:7oqyY	0.025	0.149	1.812	92	0.019	0.141	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
17	PDB:6ff4t	0.045	0.116	2.050	172	0.032	0.128	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:7uy7B	0.051	0.094	2.050	291	0.035	0.082	7uy7B.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
19	PDB:7uhyA	0.046	0.043	2.320	771	0.035	0.031	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:7c4cA	0.045	0.073	2.626	332	0.041	0.084	7c4cA.pdb.gz	Structural basis for guide RNA trimming by RNase D ribonuclease in Trypanosoma brucei.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5NBY9	0.0	1399	687	0.990	0.990	PATZ1_MOUSE POZ (BTB) and AT hook-containing zinc finger 1 OS=Mus musculus OX=10090 GN=Patz1 PE=1 SV=1
2	Q9HBE1	0.0	1412	687	1.000	1.000	PATZ1_HUMAN POZ-, AT hook-, and zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=PATZ1 PE=1 SV=1
3	Q9JMG9	0.0	1282	641	0.923	0.989	Q9JMG9_MOUSE POZ (BTB) and AT hook containing zinc finger 1 OS=Mus musculus OX=10090 GN=Patz1 PE=1 SV=1
4	P56270	7.86e-74	248	477	0.186	0.268	MAZ_HUMAN Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ PE=1 SV=1
5	P56671	8.11e-74	248	477	0.185	0.266	MAZ_MOUSE Myc-associated zinc finger protein OS=Mus musculus OX=10090 GN=Maz PE=1 SV=1
6	Q9Z162	7.44e-69	236	518	0.144	0.191	Q9Z162_MOUSE Vascular endothelial zinc finger 1 OS=Mus musculus OX=10090 GN=Vezf1 PE=2 SV=1
7	Q5SXC4	7.91e-69	236	518	0.144	0.191	Q5SXC4_MOUSE Vascular endothelial zinc finger 1 OS=Mus musculus OX=10090 GN=Vezf1 PE=1 SV=1
8	J3QSH4	8.17e-69	236	512	0.144	0.193	J3QSH4_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=1
9	Q14119	9.52e-69	236	521	0.144	0.190	VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=2
10	Q5SXC3	1.62e-57	200	336	0.127	0.259	Q5SXC3_MOUSE Vascular endothelial zinc finger 1 (Fragment) OS=Mus musculus OX=10090 GN=Vezf1 PE=1 SV=1
11	J9JIC7	1.90e-57	200	340	0.127	0.256	J9JIC7_HUMAN Vascular endothelial zinc finger 1 (Fragment) OS=Homo sapiens OX=9606 GN=VEZF1 PE=1 SV=1
12	Q99MD8	3.14e-37	149	610	0.178	0.200	MYNN_MOUSE Myoneurin OS=Mus musculus OX=10090 GN=Mynn PE=2 SV=2
13	Q9NPC7	1.10e-33	139	610	0.197	0.221	MYNN_HUMAN Myoneurin OS=Homo sapiens OX=9606 GN=MYNN PE=1 SV=1
14	P10074	4.84e-33	137	688	0.237	0.237	TZAP_HUMAN Telomere zinc finger-associated protein OS=Homo sapiens OX=9606 GN=ZBTB48 PE=1 SV=2
15	P51522	1.88e-32	134	516	0.166	0.221	ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens OX=9606 GN=ZNF83 PE=2 SV=3
16	Q96H40	2.06e-32	133	463	0.154	0.229	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
17	F1LMU5	1.12e-31	130	449	0.169	0.258	F1LMU5_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=1 SV=2
18	Q08376	1.12e-31	130	449	0.169	0.258	ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus OX=10090 GN=Zbtb14 PE=2 SV=1
19	Q8CGQ6	1.71e-31	130	449	0.169	0.258	Q8CGQ6_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=2 SV=1
20	O43829	2.08e-31	130	449	0.170	0.261	ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04959 ARS2	5.3e+02	12.2	Arsenite-resistance protein 2
2	PF00651 BTB	3e-22	90.3	BTB/POZ domain
3	PF09237 GAGA	9.2e+02	11.3	GAGA factor
4	PF00096 zf-C2H2	4.6e-23	91.5	Zinc finger, C2H2 type
5	PF12756 zf-C2H2_2	7.6e+02	11.9	C2H2 type zinc-finger (2 copies)
6	PF18868 zf-C2H2_3rep	1.9	20.6	Zinc finger C2H2-type, 3 repeats
7	PF13894 zf-C2H2_4	1.3e-24	95.7	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	3e-08	44.7	C2H2-type zinc finger
9	PF16637 zf-C2H2_assoc3	1.5e-20	84.7	Putative zinc-finger between two C2H2 zinc-fingers on Patz
10	PF12171 zf-C2H2_jaz	9.4e-06	37.0	Zinc-finger double-stranded RNA-binding
11	PF05605 zf-Di19	0.25	23.0	Drought induced 19 protein (Di19), zinc-binding
12	PF13465 zf-H2C2_2	9.7e-11	52.8	Zinc-finger double domain
13	PF12874 zf-met	8.9e-09	46.7	Zinc-finger of C2H2 type
14	PF18279 zf-WRNIP1_ubi	8.2e+02	12.1	Werner helicase-interacting protein 1 ubiquitin-binding domain
15	PF18508 zf_C2H2_13	9.3e+02	10.8	Zinc finger domain
16	PF18439 zf_UBZ	86	14.2	Ubiquitin-Binding Zinc Finger
17	PF09723 Zn-ribbon_8	17	16.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003938467.1

Rank	PPI partner	STRING score	Description
1	27679.XP_010338184.1	0.752	Nuclear receptor corepressor 1 isoform X1
2	27679.XP_010343511.1	0.739	E3 ubiquitin-protein ligase RNF4
3	27679.XP_003929235.1	0.679	Acts as a tumor suppressor in many tumor types
4	27679.XP_010346351.1	0.584	ETS translocation variant 2
5	27679.XP_003922856.1	0.574	TLD domain-containing protein 1
6	27679.XP_010328659.1	0.574	T-cell surface glycoprotein CD8 beta chain isoform X3
7	27679.XP_010334246.1	0.571	Haloacid dehalogenase-like hydrolase domain-containing protein 3
8	27679.XP_010337532.1	0.543	LOW QUALITY PROTEIN: transcription factor AP-4
9	27679.XP_003939779.1	0.538	E3 ubiquitin-protein ligase Topors
10	27679.XP_010345938.1	0.526	Nuclear receptor corepressor 2 isoform X1
11	27679.XP_003929592.1	0.522	Hematopoietic prostaglandin D synthase
12	27679.XP_003920685.1	0.514	Fibrillin-2
13	27679.XP_003937225.1	0.514	Homeobox protein Nkx-3.1
14	27679.XP_010332298.1	0.500	Transcription factor AP-2-beta isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.994	transcription regulator activity
GO:0003700	0.975	DNA-binding transcription factor activity
GO:0000981	0.966	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0019899	0.665	enzyme binding
GO:0044389	0.656	ubiquitin-like protein ligase binding
GO:0001217	0.476	DNA-binding transcription repressor activity
GO:0001228	0.382	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.998	regulation of primary metabolic process
GO:0060255	0.998	regulation of macromolecule metabolic process
GO:0051171	0.998	regulation of nitrogen compound metabolic process
GO:0031323	0.998	regulation of cellular metabolic process
GO:0009889	0.997	regulation of biosynthetic process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0048518	0.961	positive regulation of biological process
GO:0048519	0.865	negative regulation of biological process
GO:0048523	0.805	negative regulation of cellular process
GO:0048522	0.769	positive regulation of cellular process
GO:0051173	0.743	positive regulation of nitrogen compound metabolic process
GO:0010604	0.730	positive regulation of macromolecule metabolic process
GO:0031325	0.727	positive regulation of cellular metabolic process
GO:0006357	0.646	regulation of transcription by RNA polymerase II
GO:0009987	0.540	cellular process
GO:0045935	0.529	positive regulation of nucleobase-containing compound metabolic process
GO:0010605	0.503	negative regulation of macromolecule metabolic process
GO:0051254	0.486	positive regulation of RNA metabolic process
GO:0031328	0.485	positive regulation of cellular biosynthetic process
GO:0045893	0.480	positive regulation of DNA-templated transcription
GO:0045934	0.438	negative regulation of nucleobase-containing compound metabolic process
GO:1902679	0.429	negative regulation of RNA biosynthetic process
GO:1903507	0.423	negative regulation of nucleic acid-templated transcription
GO:0032502	0.397	developmental process
GO:0045892	0.387	negative regulation of DNA-templated transcription
GO:0045944	0.321	positive regulation of transcription by RNA polymerase II
GO:0048856	0.310	anatomical structure development
GO:0032501	0.308	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.322	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]