StarFunc result for job id Q9HBE4

User Input

>input (162 residues)
MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEF
LPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRL
TCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBE4	1.000	1.000	5.690E-28	162	1.000	1.000	Q9HBE4.pdb.gz	IL21_HUMAN Interleukin-21 OS=Homo sapiens OX=9606 GN=IL21 PE=1 SV=3
2	AFDB:Q9ES17	0.753	0.830	1.565E-16	146	0.556	0.616	Q9ES17.pdb.gz	IL21_MOUSE Interleukin-21 OS=Mus musculus OX=10090 GN=Il21 PE=2 SV=1
3	PDB:2oqpA	0.653	0.775	3.013E-15	134	0.796	0.963	2oqpA.pdb.gz
4	AFDB:F4MJ51	0.524	0.516	6.803E-4	165	0.204	0.200	F4MJ51.pdb.gz	F4MJ51_ONCMY Interleukin-21 OS=Oncorhynchus mykiss OX=8022 GN=il-21 PE=2 SV=1
5	AFDB:P48346	0.503	0.503	8.562E-4	162	0.136	0.136	P48346.pdb.gz	IL15_MOUSE Interleukin-15 OS=Mus musculus OX=10090 GN=Il15 PE=1 SV=1
6	AFDB:A0A060Y1P2	0.560	0.488	1.141E-3	193	0.167	0.140	A0A060Y1P2.pdb.gz	A0A060Y1P2_ONCMY Interleukin OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00030480001 PE=3 SV=1
7	AFDB:P40933	0.553	0.553	1.808E-3	162	0.191	0.191	P40933.pdb.gz	IL15_HUMAN Interleukin-15 OS=Homo sapiens OX=9606 GN=IL15 PE=1 SV=1
8	AFDB:O42288	0.517	0.582	9.050E-3	143	0.123	0.140	O42288.pdb.gz	O42288_CHICK Interleukin OS=Gallus gallus OX=9031 GN=IL2 PE=2 SV=1
9	AFDB:C7AL04	0.510	0.573	1.278E-2	142	0.160	0.183	C7AL04.pdb.gz	C7AL04_ONCMY Interleukin OS=Oncorhynchus mykiss OX=8022 GN=IL-2A PE=2 SV=1
10	AFDB:P04351	0.409	0.396	1.013E-1	169	0.173	0.166	P04351.pdb.gz	IL2_MOUSE Interleukin-2 OS=Mus musculus OX=10090 GN=Il2 PE=1 SV=1
11	AFDB:Q6EBC2	0.265	0.263	1.137E-1	164	0.160	0.159	Q6EBC2.pdb.gz	IL31_HUMAN Interleukin-31 OS=Homo sapiens OX=9606 GN=IL31 PE=1 SV=1
12	PDB:7ra9A	0.355	0.435	3.680E-1	126	0.123	0.159	7ra9A.pdb.gz
13	PDB:1ax8A	0.356	0.428	4.632E-1	130	0.117	0.146	1ax8A.pdb.gz
14	PDB:4nemA	0.331	0.439	5.197E-1	114	0.117	0.167	4nemA.pdb.gz	Small molecular fragments bound to binding energy hot-spot in crystal contact interface of Interleukin-2
15	PDB:3qb1G	0.349	0.473	5.830E-1	111	0.123	0.180	3qb1G.pdb.gz
16	PDB:1irlA	0.284	0.317	6.175E-1	133	0.154	0.188	1irlA.pdb.gz
17	PDB:1buyA	0.391	0.384	1.463	166	0.099	0.096	1buyA.pdb.gz
18	PDB:1bp3A	0.331	0.297	2.066	186	0.160	0.140	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
19	PDB:1ga3A	0.235	0.308	2.189	113	0.093	0.133	1ga3A.pdb.gz
20	PDB:1huwA	0.325	0.319	3.467	166	0.130	0.127	1huwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HBE4	7.28e-121	339	162	1.000	1.000	IL21_HUMAN Interleukin-21 OS=Homo sapiens OX=9606 GN=IL21 PE=1 SV=3
2	Q9ES17	5.40e-64	194	146	0.568	0.630	IL21_MOUSE Interleukin-21 OS=Mus musculus OX=10090 GN=Il21 PE=2 SV=1
3	E4W7U2	0.015	36.2	140	0.247	0.286	E4W7U2_ONCMY IL-21 OS=Oncorhynchus mykiss OX=8022 GN=il21 PE=2 SV=1
4	F4MJ51	0.10	34.3	165	0.222	0.218	F4MJ51_ONCMY Interleukin-21 OS=Oncorhynchus mykiss OX=8022 GN=il-21 PE=2 SV=1
5	P14719	0.68	32.3	567	0.130	0.037	ILRL1_MOUSE Interleukin-1 receptor-like 1 OS=Mus musculus OX=10090 GN=Il1rl1 PE=1 SV=2
6	P20459	1.8	30.8	304	0.111	0.059	IF2A_YEAST Eukaryotic translation initiation factor 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUI2 PE=1 SV=1
7	P97604	2.2	30.4	162	0.117	0.117	IL15_RAT Interleukin-15 OS=Rattus norvegicus OX=10116 GN=Il15 PE=2 SV=1
8	M9MRH0	3.7	30.0	543	0.111	0.033	M9MRH0_DROME RluA pseudouridine synthase 2, isoform C OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=1
9	Q9VKU8	3.8	30.0	547	0.111	0.033	Q9VKU8_DROME LD40728p OS=Drosophila melanogaster OX=7227 GN=RluA-2 PE=1 SV=2
10	F4K3G5	6.2	29.6	1297	0.111	0.014	EDM2_ARATH Protein ENHANCED DOWNY MILDEW 2 OS=Arabidopsis thaliana OX=3702 GN=EDM2 PE=1 SV=1
11	P32459	7.7	28.9	195	0.086	0.072	ALLA_YEAST Ureidoglycolate lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAL3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02372 IL15	0.0017	29.8	Interleukin 15

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264497

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338010	0.997	Interleukin-21 receptor
2	9606.ENSP00000363318	0.938	Cytokine receptor common subunit gamma
3	9606.ENSP00000264657	0.885	Signal transducer and activator of transcription 3
4	9606.ENSP00000391676	0.881	Tyrosine-protein kinase JAK3
5	9606.ENSP00000343204	0.871	Tyrosine-protein kinase JAK1
6	9606.ENSP00000354394	0.818	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000341208	0.805	Signal transducer and activator of transcription 5A
8	9606.ENSP00000412237	0.803	Interleukin-10
9	9606.ENSP00000293328	0.802	Signal transducer and activator of transcription 5B
10	9606.ENSP00000376134	0.802	Signal transducer and activator of transcription 4
11	9606.ENSP00000344192	0.800	Interleukin-17A
12	9606.ENSP00000011653	0.799	T-cell surface glycoprotein CD4
13	9606.ENSP00000385675	0.799	Interleukin-6
14	9606.ENSP00000216223	0.776	Interleukin-2 receptor subunit beta
15	9606.ENSP00000369293	0.774	Interleukin-2 receptor subunit alpha
16	9606.ENSP00000229135	0.762	Interferon gamma
17	9606.ENSP00000321345	0.758	Interleukin-23 receptor
18	9606.ENSP00000226730	0.751	Interleukin-2
19	9606.ENSP00000231449	0.750	Interleukin-4
20	9606.ENSP00000398698	0.749	Tumor necrosis factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070851	1.000	growth factor receptor binding
GO:0005126	1.000	cytokine receptor binding
GO:0005134	0.960	interleukin-2 receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0001817	0.981	regulation of cytokine production
GO:0050794	0.980	regulation of cellular process
GO:0048518	0.979	positive regulation of biological process
GO:0009987	0.978	cellular process
GO:0050896	0.977	response to stimulus
GO:0001819	0.973	positive regulation of cytokine production
GO:0048584	0.966	positive regulation of response to stimulus
GO:0051251	0.965	positive regulation of lymphocyte activation
GO:0032103	0.958	positive regulation of response to external stimulus
GO:0001934	0.956	positive regulation of protein phosphorylation
GO:0007165	0.952	signal transduction
GO:0002697	0.948	regulation of immune effector process
GO:0048856	0.947	anatomical structure development
GO:0050778	0.947	positive regulation of immune response
GO:0031349	0.946	positive regulation of defense response
GO:0007166	0.944	cell surface receptor signaling pathway
GO:0009605	0.941	response to external stimulus
GO:0006950	0.939	response to stress
GO:0002699	0.938	positive regulation of immune effector process
GO:0018108	0.936	peptidyl-tyrosine phosphorylation
GO:0050727	0.934	regulation of inflammatory response
GO:0050731	0.926	positive regulation of peptidyl-tyrosine phosphorylation
GO:0002831	0.922	regulation of response to biotic stimulus
GO:0002703	0.917	regulation of leukocyte mediated immunity
GO:0002708	0.908	positive regulation of lymphocyte mediated immunity
GO:0008284	0.907	positive regulation of cell population proliferation
GO:0006952	0.901	defense response
GO:0031341	0.870	regulation of cell killing
GO:0070663	0.864	regulation of leukocyte proliferation
GO:0042509	0.864	regulation of tyrosine phosphorylation of STAT protein
GO:0032501	0.857	multicellular organismal process
GO:0030155	0.857	regulation of cell adhesion
GO:0043207	0.845	response to external biotic stimulus
GO:0051707	0.840	response to other organism
GO:0045088	0.812	regulation of innate immune response
GO:0031343	0.807	positive regulation of cell killing
GO:0045089	0.780	positive regulation of innate immune response
GO:0002376	0.758	immune system process
GO:0002715	0.737	regulation of natural killer cell mediated immunity
GO:0097696	0.717	receptor signaling pathway via STAT
GO:0002717	0.701	positive regulation of natural killer cell mediated immunity
GO:0042221	0.691	response to chemical
GO:0042531	0.673	positive regulation of tyrosine phosphorylation of STAT protein
GO:0048869	0.594	cellular developmental process
GO:0030154	0.548	cell differentiation
GO:0032944	0.532	regulation of mononuclear cell proliferation
GO:0070665	0.526	positive regulation of leukocyte proliferation
GO:0050670	0.518	regulation of lymphocyte proliferation
GO:0006955	0.513	immune response
GO:0098542	0.506	defense response to other organism
GO:0050671	0.503	positive regulation of lymphocyte proliferation
GO:0001910	0.483	regulation of leukocyte mediated cytotoxicity
GO:0009615	0.476	response to virus
GO:0048519	0.454	negative regulation of biological process
GO:0048468	0.453	cell development
GO:0010033	0.444	response to organic substance
GO:0009966	0.427	regulation of signal transduction
GO:0001912	0.424	positive regulation of leukocyte mediated cytotoxicity
GO:0042269	0.423	regulation of natural killer cell mediated cytotoxicity
GO:0070887	0.422	cellular response to chemical stimulus
GO:0034097	0.415	response to cytokine
GO:0045954	0.395	positive regulation of natural killer cell mediated cytotoxicity
GO:0001775	0.384	cell activation
GO:0071310	0.370	cellular response to organic substance
GO:0050729	0.360	positive regulation of inflammatory response
GO:0071345	0.342	cellular response to cytokine stimulus
GO:0050793	0.323	regulation of developmental process
GO:0009967	0.320	positive regulation of signal transduction
GO:0048523	0.302	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005615	0.661	extracellular space
GO:0005622	0.606	intracellular anatomical structure
GO:0005737	0.561	cytoplasm
GO:0071944	0.518	cell periphery
GO:0043231	0.497	intracellular membrane-bounded organelle
GO:0005886	0.490	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]