StarFunc result for job id Q9HBE5

User Input

>input (538 residues)
MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSS
LELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGG
SAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBE5	1.000	1.000	6.308E-91	538	1.000	1.000	Q9HBE5.pdb.gz	IL21R_HUMAN Interleukin-21 receptor OS=Homo sapiens OX=9606 GN=IL21R PE=1 SV=1
2	AFDB:Q9JHX3	0.486	0.494	1.447E-62	529	0.632	0.643	Q9JHX3.pdb.gz	IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus OX=10090 GN=Il21r PE=2 SV=1
3	AFDB:P16297	0.352	0.352	1.536E-22	539	0.201	0.200	P16297.pdb.gz	IL2RB_MOUSE Interleukin-2 receptor subunit beta OS=Mus musculus OX=10090 GN=Il2rb PE=1 SV=1
4	AFDB:P26896	0.338	0.339	1.915E-22	537	0.212	0.212	P26896.pdb.gz	IL2RB_RAT Interleukin-2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il2rb PE=2 SV=1
5	AFDB:Q5MKL1	0.285	0.263	7.297E-17	594	0.184	0.167	Q5MKL1.pdb.gz	Q5MKL1_ONCMY Growth hormone receptor OS=Oncorhynchus mykiss OX=8022 GN=GHR2b PE=2 SV=1
6	AFDB:P19756	0.292	0.254	9.749E-16	638	0.171	0.144	P19756.pdb.gz	GHR_PIG Growth hormone receptor OS=Sus scrofa OX=9823 GN=GHR PE=1 SV=1
7	AFDB:Q8N6P7	0.239	0.226	4.035E-12	574	0.178	0.167	Q8N6P7.pdb.gz	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL22RA1 PE=1 SV=1
8	PDB:7u7nC	0.260	0.613	2.617E-11	200	0.082	0.220	7u7nC.pdb.gz
9	AFDB:P42702	0.189	0.106	3.106E-11	1097	0.158	0.077	P42702.pdb.gz	LIFR_HUMAN Leukemia inhibitory factor receptor OS=Homo sapiens OX=9606 GN=LIFR PE=1 SV=1
10	AFDB:G5EBF1	0.180	0.085	2.820E-10	1273	0.149	0.063	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
11	AFDB:Q8C310	0.195	0.121	3.516E-10	1012	0.180	0.096	Q8C310.pdb.gz	ROBO4_MOUSE Roundabout homolog 4 OS=Mus musculus OX=10090 GN=Robo4 PE=1 SV=2
12	PDB:7z0lB	0.264	0.367	6.502E-9	370	0.078	0.114	7z0lB.pdb.gz
13	PDB:5mj3A	0.253	0.412	7.260E-9	302	0.071	0.126	5mj3A.pdb.gz
14	PDB:3besR	0.212	0.388	3.851E-7	250	0.059	0.128	3besR.pdb.gz
15	PDB:8eyyA	0.170	0.127	9.308E-7	775	0.056	0.039	8eyyA.pdb.gz
16	PDB:6pxvA	0.182	0.127	6.071E-6	823	0.065	0.043	6pxvA.pdb.gz
17	PDB:1e07A	0.181	0.157	8.111E-5	642	0.052	0.044	1e07A.pdb.gz
18	PDB:1lilA	0.143	0.270	8.111E-5	212	0.056	0.142	1lilA.pdb.gz
19	PDB:6pyhD	0.175	0.124	9.056E-5	798	0.043	0.029	6pyhD.pdb.gz
20	PDB:5oj2B	0.160	0.133	1.755E-4	692	0.061	0.048	5oj2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HBE5	0.0	1089	538	1.000	1.000	IL21R_HUMAN Interleukin-21 receptor OS=Homo sapiens OX=9606 GN=IL21R PE=1 SV=1
2	Q9JHX3	0.0	625	529	0.632	0.643	IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus OX=10090 GN=Il21r PE=2 SV=1
3	Q2VBQ8	5.96e-14	76.6	509	0.191	0.202	Q2VBQ8_DANRE Erythropoietin receptor OS=Danio rerio OX=7955 GN=epor PE=2 SV=1
4	Q01113	9.04e-11	66.6	521	0.141	0.146	IL9R_HUMAN Interleukin-9 receptor OS=Homo sapiens OX=9606 GN=IL9R PE=1 SV=3
5	P14784	2.49e-10	65.5	551	0.156	0.152	IL2RB_HUMAN Interleukin-2 receptor subunit beta OS=Homo sapiens OX=9606 GN=IL2RB PE=1 SV=1
6	P16297	2.64e-10	65.1	539	0.160	0.160	IL2RB_MOUSE Interleukin-2 receptor subunit beta OS=Mus musculus OX=10090 GN=Il2rb PE=1 SV=1
7	Q01114	9.60e-10	63.2	468	0.108	0.124	IL9R_MOUSE Interleukin-9 receptor OS=Mus musculus OX=10090 GN=Il9r PE=1 SV=1
8	P26954	2.90e-09	62.4	878	0.104	0.064	IL3B2_MOUSE Interleukin-3 receptor class 2 subunit beta OS=Mus musculus OX=10090 GN=Csf2rb2 PE=1 SV=1
9	Q63216	7.33e-09	60.5	467	0.112	0.128	Q63216_RAT Gfi-2 protein OS=Rattus norvegicus OX=10116 GN=Il9r PE=2 SV=1
10	G3V8S1	7.40e-09	60.5	467	0.112	0.128	G3V8S1_RAT Interleukin 9 receptor OS=Rattus norvegicus OX=10116 GN=Il9r PE=4 SV=1
11	A0A8I6AHK3	7.41e-09	60.5	468	0.112	0.128	A0A8I6AHK3_RAT Interleukin 9 receptor OS=Rattus norvegicus OX=10116 GN=Il9r PE=4 SV=1
12	A0A8I6GE59	1.80e-07	56.6	787	0.104	0.071	A0A8I6GE59_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=1
13	P26896	1.88e-07	56.2	537	0.147	0.147	IL2RB_RAT Interleukin-2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Il2rb PE=2 SV=1
14	G3V608	1.93e-07	56.6	896	0.104	0.062	G3V608_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=3
15	Q78ZF5	2.33e-07	56.2	896	0.104	0.062	Q78ZF5_RAT Interleukin-3 receptor beta-subunit OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=2 SV=1
16	P24394	3.26e-07	55.8	825	0.117	0.076	IL4RA_HUMAN Interleukin-4 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL4R PE=1 SV=1
17	Q4W815	6.89e-07	54.3	525	0.158	0.162	EPOR_XENLA Erythropoietin receptor OS=Xenopus laevis OX=8355 GN=epor PE=2 SV=1
18	P26955	1.79e-06	53.1	896	0.084	0.050	IL3RB_MOUSE Cytokine receptor common subunit beta OS=Mus musculus OX=10090 GN=Csf2rb PE=1 SV=2
19	P16871	2.81e-06	52.4	459	0.071	0.083	IL7RA_HUMAN Interleukin-7 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL7R PE=1 SV=3
20	A0A8I5Y685	3.23e-06	52.4	540	0.102	0.102	A0A8I5Y685_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	9.8e+02	11.4	Erythropoietin receptor, ligand binding
2	PF09238 IL4Ra_N	0.89	21.3	Interleukin-4 receptor alpha chain, N-terminal
3	PF11031 Phage_holin_T	46	15.0	Bacteriophage T holin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338010

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264497	0.997	Interleukin-21
2	9606.ENSP00000363318	0.963	Cytokine receptor common subunit gamma
3	9606.ENSP00000343204	0.947	Tyrosine-protein kinase JAK1
4	9606.ENSP00000264657	0.902	Signal transducer and activator of transcription 3
5	9606.ENSP00000391676	0.896	Tyrosine-protein kinase JAK3
6	9606.ENSP00000442424	0.826	Interleukin-22
7	9606.ENSP00000226730	0.816	Interleukin-2
8	9606.ENSP00000231449	0.814	Interleukin-4
9	9606.ENSP00000296545	0.810	Interleukin-15
10	9606.ENSP00000292174	0.791	C-X-C chemokine receptor type 5
11	9606.ENSP00000412237	0.790	Interleukin-10
12	9606.ENSP00000263851	0.782	Interleukin-7
13	9606.ENSP00000376134	0.780	Signal transducer and activator of transcription 4
14	9606.ENSP00000354394	0.779	Signal transducer and activator of transcription 1-alpha/beta
15	9606.ENSP00000274520	0.776	Interleukin-9
16	9606.ENSP00000385675	0.776	Interleukin-6
17	9606.ENSP00000341208	0.775	Signal transducer and activator of transcription 5A
18	9606.ENSP00000293328	0.774	Signal transducer and activator of transcription 5B
19	9606.ENSP00000011653	0.757	T-cell surface glycoprotein CD4
20	9606.ENSP00000229135	0.751	Interferon gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0023052	0.987	signaling
GO:0007154	0.983	cell communication
GO:0048522	0.953	positive regulation of cellular process
GO:0051716	0.839	cellular response to stimulus
GO:0007165	0.810	signal transduction
GO:0019222	0.803	regulation of metabolic process
GO:0032501	0.732	multicellular organismal process
GO:0060255	0.662	regulation of macromolecule metabolic process
GO:0007166	0.646	cell surface receptor signaling pathway
GO:0009893	0.602	positive regulation of metabolic process
GO:0048583	0.539	regulation of response to stimulus
GO:0010604	0.534	positive regulation of macromolecule metabolic process
GO:0010468	0.522	regulation of gene expression
GO:0048856	0.520	anatomical structure development
GO:0031323	0.493	regulation of cellular metabolic process
GO:0042221	0.475	response to chemical
GO:0010033	0.458	response to organic substance
GO:0070887	0.442	cellular response to chemical stimulus
GO:0051239	0.398	regulation of multicellular organismal process
GO:0048519	0.385	negative regulation of biological process
GO:0042127	0.381	regulation of cell population proliferation
GO:0048523	0.376	negative regulation of cellular process
GO:0048584	0.371	positive regulation of response to stimulus
GO:0006950	0.364	response to stress
GO:0071345	0.357	cellular response to cytokine stimulus
GO:0019221	0.349	cytokine-mediated signaling pathway
GO:0023051	0.345	regulation of signaling
GO:0010646	0.344	regulation of cell communication
GO:0009966	0.334	regulation of signal transduction
GO:0080090	0.324	regulation of primary metabolic process
GO:0002376	0.322	immune system process
GO:0051171	0.300	regulation of nitrogen compound metabolic process
GO:0008284	0.300	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.711	intracellular anatomical structure
GO:0043226	0.678	organelle
GO:0043227	0.588	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]