StarFunc result for job id Q9HBF5

User Input

>input (79 residues)
MARSRLTATSVSQVQENGFVKKLEPKSGWMTFLEVTGKICEMLFCPEAILLTRKDTPYCE
TGLIFLTLTKTIANTYFYF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBF5	1.000	1.000	1.942E-12	79	1.000	1.000	Q9HBF5.pdb.gz	ST20_HUMAN Suppressor of tumorigenicity 20 protein OS=Homo sapiens OX=9606 GN=ST20 PE=2 SV=2
2	AFDB:P24502	0.380	0.300	4.411	106	0.152	0.113	P24502.pdb.gz	FLIE_BACSU Flagellar hook-basal body complex protein FliE OS=Bacillus subtilis (strain 168) OX=224308 GN=fliE PE=3 SV=1
3	AFDB:G5EEG9	0.355	0.111	6.210	399	0.089	0.018	G5EEG9.pdb.gz	HLH2_CAEEL Helix-loop-helix protein hlh-2 OS=Caenorhabditis elegans OX=6239 GN=hlh-2 PE=1 SV=1
4	AFDB:Q21121	0.241	0.079	6.650	333	0.127	0.030	Q21121.pdb.gz	MCU_CAEEL Calcium uniporter protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mcu-1 PE=1 SV=2
5	AFDB:P41739	0.344	0.059	7.624	800	0.139	0.014	P41739.pdb.gz	ARNT_RAT Aryl hydrocarbon receptor nuclear translocator OS=Rattus norvegicus OX=10116 GN=Arnt PE=1 SV=2
6	PDB:6o58A	0.199	0.086	7.852	273	0.152	0.044	6o58A.pdb.gz
7	AFDB:Q7KM13	0.245	0.066	9.361	425	0.101	0.019	Q7KM13.pdb.gz	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HBF5	4.20e-54	164	79	1.000	1.000	ST20_HUMAN Suppressor of tumorigenicity 20 protein OS=Homo sapiens OX=9606 GN=ST20 PE=2 SV=2
2	Q16548	1.29e-12	61.2	175	0.342	0.154	B2LA1_HUMAN Bcl-2-related protein A1 OS=Homo sapiens OX=9606 GN=BCL2A1 PE=1 SV=1
3	Q3TN22	1.02e-09	52.8	131	0.266	0.160	Q3TN22_MOUSE Bcl-2 Bcl-2 homology region 1-3 domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Bcl2a1d PE=2 SV=1
4	O55179	1.48e-09	53.1	172	0.266	0.122	O55179_MOUSE A1-d protein OS=Mus musculus OX=10090 GN=Bcl2a1d PE=2 SV=1
5	Q07440	1.66e-09	53.1	172	0.266	0.122	B2LA1_MOUSE Bcl-2-related protein A1 OS=Mus musculus OX=10090 GN=Bcl2a1 PE=1 SV=1
6	G3V977	1.92e-09	53.1	175	0.278	0.126	G3V977_RAT BCL2-related protein A1 OS=Rattus norvegicus OX=10116 GN=Bcl2a1 PE=3 SV=1
7	Q925A9	2.07e-09	52.8	175	0.278	0.126	Q925A9_RAT BCL2-related protein A1 OS=Rattus norvegicus OX=10116 GN=Bcl2a1 PE=2 SV=1
8	Q38CI1	0.16	31.6	713	0.139	0.015	Q38CI1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7670 PE=4 SV=1
9	A0A2R8Y645	0.33	30.8	716	0.253	0.028	A0A2R8Y645_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=1
10	O91464	3.6	28.1	2432	0.190	0.006	POLG_AIVA8 Genome polyprotein OS=Aichi virus (strain Human/A846/88/1989) OX=650132 PE=1 SV=2
11	Q9LXZ7	4.5	27.7	434	0.177	0.032	Q9LXZ7_ARATH At3g56430 OS=Arabidopsis thaliana OX=3702 GN=ATTIM21L-2 PE=1 SV=1
12	A0A2R8Y5D3	5.4	27.3	343	0.152	0.035	A0A2R8Y5D3_HUMAN DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1
13	P21865	7.0	26.9	894	0.266	0.023	KDPD_ECOLI Sensor protein KdpD OS=Escherichia coli (strain K12) OX=83333 GN=kdpD PE=1 SV=2
14	Q4V516	9.7	26.6	897	0.228	0.020	DRC7_DROME Coiled-coil domain-containing protein lobo OS=Drosophila melanogaster OX=7227 GN=lobo PE=1 SV=1
15	Q9Z0W0	10.0	26.6	550	0.127	0.018	GLP2R_RAT Glucagon-like peptide 2 receptor OS=Rattus norvegicus OX=10116 GN=Glp2r PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000453502

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329797	0.665	Cell adhesion molecule 1
2	9606.ENSP00000375795	0.653	Interleukin-24
3	9606.ENSP00000448165	0.588	Apoptotic protease-activating factor 1
4	9606.ENSP00000433528	0.518	Suppression of tumorigenicity 5 protein
5	9606.ENSP00000261692	0.501	Cyclin-dependent kinase 2-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061134	0.996	peptidase regulator activity
GO:0043028	0.996	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0016504	0.949	peptidase activator activity
GO:0016505	0.941	peptidase activator activity involved in apoptotic process
GO:0008656	0.926	cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0005488	0.771	binding
GO:0005515	0.689	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0050794	0.961	regulation of cellular process
GO:0048518	0.953	positive regulation of biological process
GO:0050896	0.942	response to stimulus
GO:0060255	0.940	regulation of macromolecule metabolic process
GO:0048522	0.816	positive regulation of cellular process
GO:0010604	0.810	positive regulation of macromolecule metabolic process
GO:0051246	0.768	regulation of protein metabolic process
GO:0065009	0.719	regulation of molecular function
GO:0052548	0.565	regulation of endopeptidase activity
GO:0051247	0.532	positive regulation of protein metabolic process
GO:0006915	0.477	apoptotic process
GO:2000116	0.467	regulation of cysteine-type endopeptidase activity
GO:0044093	0.440	positive regulation of molecular function
GO:0043281	0.439	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:2001056	0.428	positive regulation of cysteine-type endopeptidase activity
GO:0051716	0.404	cellular response to stimulus
GO:0048519	0.398	negative regulation of biological process
GO:0006919	0.389	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0048523	0.376	negative regulation of cellular process
GO:0007165	0.360	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0043229	0.995	intracellular organelle
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0005634	0.843	nucleus
GO:0005829	0.627	cytosol
GO:0005739	0.420	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]