StarFunc result for job id Q9HBG6

User Input

>input (1241 residues)
MRAVLTWRDKAEHCINDIAFKPDGTQLILAAGSRLLVYDTSDGTLLQPLKGHKDTVYCVA
YAKDGKRFASGSADKSVIIWTSKLEGILKYTHNDAIQCVSYNPITHQLASCSSSDFGLWS
PEQKSVSKHKSSSKIICCSWTNDGQYLALGMFNGIISIRNKNGEEKVKIERPGGSLSPIW
SICWNPSSRWESFWMNRENEDAEDVIVNRYIQEIPSTLKSAVYSSQGSEAEEEEPEEEDD
SPRDDNLEERNDILAVADWGQKVSFYQLSGKQIGKDRALNFDPCCISYFTKGEYILLGGS
DKQVSLFTKDGVRLGTVGEQNSWVWTCQAKPDSNYVVVGCQDGTISFYQLIFSTVHGLYK
DRYAYRDSMTDVIVQHLITEQKVRIKCKELVKKIAIYRNRLAIQLPEKILIYELYSEDLS
DMHYRVKEKIIKKFECNLLVVCANHIILCQEKRLQCLSFSGVKEREWQMESLIRYIKVIG
GPPGREGLLVGLKNGQILKIFVDNLFAIVLLKQATAVRCLDMSASRKKLAVVDENDTCLV
YDIDTKELLFQEPNANSVAWNTQCEDMLCFSGGGYLNIKASTFPVHRQKLQGFVVGYNGS
KIFCLHVFSISAVEVPQSAPMYQYLDRKLFKEAYQIACLGVTDTDWRELAMEALEGLDFE
TAKKAFIRVQDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHEN
LALEMYTDLCMFEYAKDFLGSGDPKETKMLITKQADWARNIKEPKAAVEMYISAGEHVKA
IEICGDHGWVDMLIDIARKLDKAEREPLLLCATYLKKLDSPGYAAETYLKMGDLKSLVQL
HVETQRWDEAFALGEKHPEFKDDIYMPYAQWLAENDRFEEAQKAFHKAGRQREAVQVLEQ
LTNNAVAESRFNDAAYYYWMLSMQCLDIAQDPAQKDTMLGKFYHFQRLAELYHGYHAIHR
HTEDPFSVHRPETLFNISRFLLHSLPKDTPSGISKVKILFTLAKQSKALGAYRLARHAYD
KLRGLYIPARFQKSIELGTLTIRAKPFHDSEELVPLCYRCSTNNPLLNNLGNVCINCRQP
FIFSASSYDVLHLVEFYLEEGITDEEAISLIDLEVLRPKRDDRQLEIANNSSQILRLVET
KDSIGDEDPFTAKLSFEQGGSEFVPVVVSRLVLRSMSRRDVLIKRWPPPLRWQYFRSLLP
DASITMCPSCFQMFHSEDYELLVLQHGCCPYCRRCKDDPGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EFW7	0.540	0.561	0.000	1192	0.380	0.396	G5EFW7.pdb.gz	IF122_CAEEL Intraflagellar transport protein 122 homolog OS=Caenorhabditis elegans OX=6239 GN=daf-10 PE=1 SV=1
2	AFDB:Q6NWV3	0.515	0.541	0.000	1182	0.871	0.915	Q6NWV3.pdb.gz	IF122_MOUSE Intraflagellar transport protein 122 homolog OS=Mus musculus OX=10090 GN=Ift122 PE=1 SV=1
3	AFDB:Q6NYH1	0.604	0.630	0.000	1187	0.738	0.772	Q6NYH1.pdb.gz	IF122_DANRE Intraflagellar transport protein 122 homolog OS=Danio rerio OX=7955 GN=ift122 PE=2 SV=1
4	AFDB:Q8T9D3	0.588	0.622	0.000	1169	0.440	0.467	Q8T9D3.pdb.gz	Q8T9D3_DROME SD05642p OS=Drosophila melanogaster OX=7227 GN=Oseg1 PE=2 SV=1
5	AFDB:Q9HBG6	1.000	1.000	0.000	1241	1.000	1.000	Q9HBG6.pdb.gz	IF122_HUMAN Intraflagellar transport protein 122 homolog OS=Homo sapiens OX=9606 GN=IFT122 PE=1 SV=2
6	AFDB:Q38B65	0.627	0.626	4.927E-103	1242	0.330	0.329	Q38B65.pdb.gz	Q38B65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1660 PE=4 SV=1
7	AFDB:Q57ZX9	0.293	0.290	8.048E-46	1260	0.156	0.153	Q57ZX9.pdb.gz	Q57ZX9_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.80 PE=4 SV=1
8	AFDB:Q9W097	0.277	0.283	3.494E-45	1205	0.151	0.155	Q9W097.pdb.gz	Q9W097_DROME LD29485p OS=Drosophila melanogaster OX=7227 GN=Oseg4 PE=2 SV=1
9	AFDB:Q8BND3	0.250	0.262	3.026E-44	1181	0.146	0.153	Q8BND3.pdb.gz	WDR35_MOUSE WD repeat-containing protein 35 OS=Mus musculus OX=10090 GN=Wdr35 PE=1 SV=3
10	AFDB:Q18859	0.256	0.256	1.372E-43	1246	0.127	0.126	Q18859.pdb.gz	Q18859_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ifta-1 PE=4 SV=4
11	PDB:5a1vK	0.269	0.290	2.515E-24	1126	0.119	0.131	5a1vK.pdb.gz
12	PDB:6qk7A	0.292	0.305	4.164E-23	1161	0.126	0.134	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
13	PDB:7mq8LO	0.199	0.286	3.124E-21	848	0.068	0.100	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mqaLQ	0.193	0.282	4.048E-21	830	0.098	0.147	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:3sfzA	0.239	0.259	5.477E-21	1133	0.081	0.089	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
16	PDB:5nzrC	0.326	0.447	4.351E-20	843	0.078	0.115	5nzrC.pdb.gz
17	PDB:7mq8LR	0.221	0.325	4.351E-20	773	0.073	0.118	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mqaLO	0.205	0.305	6.997E-20	819	0.067	0.101	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7rroe	0.200	0.391	7.964E-20	610	0.065	0.133	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:7ajuUL	0.201	0.312	3.610E-19	779	0.089	0.141	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EFW7	0.0	917	1192	0.386	0.402	IF122_CAEEL Intraflagellar transport protein 122 homolog OS=Caenorhabditis elegans OX=6239 GN=daf-10 PE=1 SV=1
2	Q38B65	0.0	746	1242	0.329	0.329	Q38B65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1660 PE=4 SV=1
3	Q6NWV3	0.0	2075	1182	0.839	0.881	IF122_MOUSE Intraflagellar transport protein 122 homolog OS=Mus musculus OX=10090 GN=Ift122 PE=1 SV=1
4	Q6NYH1	0.0	1923	1187	0.736	0.769	IF122_DANRE Intraflagellar transport protein 122 homolog OS=Danio rerio OX=7955 GN=ift122 PE=2 SV=1
5	Q8T9D3	0.0	887	1169	0.387	0.411	Q8T9D3_DROME SD05642p OS=Drosophila melanogaster OX=7227 GN=Oseg1 PE=2 SV=1
6	Q9HBG6	0.0	2586	1241	1.000	1.000	IF122_HUMAN Intraflagellar transport protein 122 homolog OS=Homo sapiens OX=9606 GN=IFT122 PE=1 SV=2
7	Q9VSJ6	0.0	887	1169	0.387	0.411	Q9VSJ6_DROME FI05482p OS=Drosophila melanogaster OX=7227 GN=Oseg1 PE=2 SV=3
8	Q9W097	4.71e-13	76.6	1205	0.059	0.061	Q9W097_DROME LD29485p OS=Drosophila melanogaster OX=7227 GN=Oseg4 PE=2 SV=1
9	C8V0I4	2.94e-09	63.5	574	0.044	0.096	C8V0I4_EMENI Transcriptional corepressor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06505 PE=4 SV=1
10	Q9UUG8	3.06e-09	63.5	598	0.040	0.084	TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tup12 PE=1 SV=2
11	Q8N136	5.30e-09	62.4	415	0.062	0.186	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
12	Q57YK0	7.42e-09	62.4	638	0.036	0.071	Q57YK0_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.880 PE=4 SV=1
13	Q8JZX3	9.10e-09	61.6	405	0.031	0.094	POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus OX=10090 GN=Poc1a PE=2 SV=2
14	Q9D994	1.38e-08	60.1	303	0.030	0.122	WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus OX=10090 GN=Wdr38 PE=2 SV=1
15	Q9VU65	2.02e-08	60.5	391	0.021	0.066	POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster OX=7227 GN=Poc1 PE=2 SV=1
16	Q9FNN2	2.31e-08	60.8	589	0.059	0.124	WDR26_ARATH WD repeat-containing protein 26 homolog OS=Arabidopsis thaliana OX=3702 GN=WDR26 PE=1 SV=1
17	Q57ZX9	3.41e-08	60.8	1260	0.058	0.057	Q57ZX9_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.80 PE=4 SV=1
18	D3Z7A5	4.67e-08	59.3	415	0.060	0.178	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
19	D6QUQ2	6.65e-08	58.9	463	0.032	0.086	D6QUQ2_9CNID Poc1 OS=Clytia hemisphaerica OX=252671 PE=2 SV=1
20	Q8NBT0	6.97e-08	58.9	407	0.029	0.088	POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	8.6e+02	11.6	Anaphase-promoting complex, cyclosome, subunit 3
2	PF12894 ANAPC4_WD40	8e-08	43.8	Anaphase-promoting complex subunit 4 WD40 domain
3	PF00637 Clathrin	14	17.0	Region in Clathrin and VPS
4	PF04053 Coatomer_WDAD	0.11	23.2	Coatomer WD associated region
5	PF08662 eIF2A	4.9	18.5	Eukaryotic translation initiation factor eIF2A
6	PF20426 NBCH_WD40	0.00039	31.0	Neurobeachin beta propeller domain
7	PF14727 PHTB1_N	98	13.7	PTHB1 N-terminus
8	PF13424 TPR_12	59	15.4	Tetratricopeptide repeat
9	PF13176 TPR_7	6.4	18.1	Tetratricopeptide repeat
10	PF19440 TTC7_N	3.4e+02	11.7	Tetratricopeptide repeat protein 7 N-terminal
11	PF00400 WD40	2.6e-13	61.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003829473.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008958000.1	0.980	Intraflagellar transport 140
2	9597.XP_003832229.2	0.977	WD repeat domain 19
3	9597.XP_003824242.1	0.965	Intraflagellar transport protein 43 homolog isoform X1
4	9597.XP_003827053.1	0.952	As a component of the IFT complex A (IFT-A), a complex required for retrograde ciliary transport and entry into cilia of G protein-coupled receptors (GPCRs), it is involved in ciliogenesis and ciliary protein trafficking
5	9597.XP_003824366.1	0.894	Tetratricopeptide repeat protein 21B
6	9597.XP_003830399.1	0.840	Chromosome 11 C11orf74 homolog
7	9597.XP_003833065.1	0.838	Intraflagellar transport 88
8	9597.XP_003825107.1	0.812	Intraflagellar transport protein 57 homolog
9	9597.XP_003830674.1	0.810	Intraflagellar transport protein 80 homolog isoform X1
10	9597.XP_003825954.1	0.784	Intraflagellar transport 52
11	9597.XP_003827157.1	0.778	Intraflagellar transport protein 172 homolog isoform X1
12	9597.XP_003828419.1	0.768	Dynein cytoplasmic 2 heavy chain 1
13	9597.XP_008949784.1	0.768	Tetratricopeptide repeat domain 21A
14	9597.XP_003832538.1	0.765	Intraflagellar transport 81
15	9597.XP_008971711.1	0.763	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 123 ESTs, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns
16	9597.XP_008972019.1	0.763	Belongs to the TUB family
17	9597.XP_008959544.1	0.760	Cytoplasmic dynein 2 light intermediate chain 1 isoform X1
18	9597.XP_008963893.1	0.756	TRAF3-interacting protein 1 isoform X1
19	9597.XP_003813457.1	0.754	Tetratricopeptide repeat domain 26
20	9597.XP_003807239.1	0.744	Intraflagellar transport protein 22 homolog isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0051641	0.992	cellular localization
GO:0070925	0.989	organelle assembly
GO:0044782	0.989	cilium organization
GO:0030031	0.987	cell projection assembly
GO:0031503	0.981	protein-containing complex localization
GO:0060271	0.976	cilium assembly
GO:0033365	0.973	protein localization to organelle
GO:0061512	0.964	protein localization to cilium
GO:0042073	0.958	intraciliary transport
GO:0050789	0.825	regulation of biological process
GO:0050794	0.773	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005929	1.000	cilium
GO:0005815	0.999	microtubule organizing center
GO:0030990	0.992	intraciliary transport particle
GO:0036064	0.986	ciliary basal body
GO:0016020	0.926	membrane
GO:0005829	0.856	cytosol
GO:0097542	0.832	ciliary tip
GO:0097730	0.505	non-motile cilium
GO:0005813	0.463	centrosome
GO:0043231	0.415	intracellular membrane-bounded organelle
GO:0035869	0.383	ciliary transition zone
GO:0043005	0.307	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]