StarFunc result for job id Q9HBG7

User Input

>input (655 residues)
MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILG
GSVTLPLNISVDTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISN
LTLNDAGSYKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMKSVKVSENFSCNITLMCSV
KGAEKSVLYSWTPREPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQ
FCTDPGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKVVWLFNTSIISKEREEAATAD
PLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMTHVTLLIYRRL
RKPKITWSLRHSEDGICRISLTCSVEDGGNTVMYTWTPLQKEAVVSQGESHLNVSWRSSE
NHPNLTCTASNPVSRSSHQFLSENICSGPERNTKLWIGLFLMVCLLCVGIFSWCIWKRKG
RCSVPAFCSSQAEAPADTPEPTAGHTLYSVLSQGYEKLDTPLRPARQQPTPTSDSSSDSN
LTTEEDEDRPEVHKPISGRYEVFDQVTQEGAGHDPAPEGQADYDPVTPYVTEVESVVGEN
TMYAQVFNLQGKTPVSQKEESSATIYCSIRKPQVVPPPQQNDLEIPESPTYENFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBG7	1.000	1.000	0.000	655	1.000	1.000	Q9HBG7.pdb.gz	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
2	AFDB:Q5VYH9	0.511	0.590	4.566E-86	565	0.863	1.000	Q5VYH9.pdb.gz	Q5VYH9_HUMAN Lymphocyte antigen 9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
3	AFDB:Q01965	0.584	0.585	1.628E-71	654	0.551	0.552	Q01965.pdb.gz	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
4	AFDB:Q9VFU7	0.163	0.109	5.411E-21	1001	0.169	0.111	Q9VFU7.pdb.gz	Q9VFU7_DROME Sidestep IV, isoform C OS=Drosophila melanogaster OX=7227 GN=side-IV PE=1 SV=3
5	AFDB:P13595	0.172	0.115	2.272E-18	1115	0.156	0.091	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
6	AFDB:Q9NQ25	0.276	0.518	4.266E-18	335	0.099	0.194	Q9NQ25.pdb.gz	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
7	AFDB:Q08180	0.151	0.136	1.599E-16	764	0.136	0.116	Q08180.pdb.gz	ICCR_DROME Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2
8	AFDB:Q9ET39	0.266	0.466	1.699E-15	351	0.102	0.191	Q9ET39.pdb.gz	SLAF6_MOUSE SLAM family member 6 OS=Mus musculus OX=10090 GN=Slamf6 PE=1 SV=1
9	AFDB:Q9W213	0.131	0.076	1.626E-14	1395	0.145	0.068	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
10	AFDB:Q9VQW7	0.179	0.103	5.441E-14	1332	0.110	0.054	Q9VQW7.pdb.gz	Q9VQW7_DROME Echinoid, isoform A OS=Drosophila melanogaster OX=7227 GN=ed PE=1 SV=2
11	PDB:1e07A	0.217	0.221	1.843E-13	642	0.119	0.121	1e07A.pdb.gz
12	PDB:5oj2B	0.214	0.205	1.959E-12	692	0.102	0.097	5oj2B.pdb.gz
13	PDB:6dldD	0.147	0.311	3.007E-11	269	0.069	0.167	6dldD.pdb.gz
14	PDB:6dlfA	0.141	0.343	2.457E-10	236	0.076	0.212	6dlfA.pdb.gz
15	PDB:1hzhH	0.172	0.218	4.155E-10	457	0.082	0.118	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
16	PDB:1igaA	0.160	0.195	9.627E-10	475	0.085	0.118	1igaA.pdb.gz
17	PDB:4rtdA	0.107	0.070	4.189E-9	1122	0.089	0.052	4rtdA.pdb.gz
18	PDB:2rcjC	0.152	0.178	5.741E-9	523	0.101	0.126	2rcjC.pdb.gz
19	PDB:1zvoC	0.141	0.165	6.050E-9	512	0.095	0.121	1zvoC.pdb.gz
20	PDB:1ngwH	0.137	0.339	8.292E-9	216	0.058	0.176	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q01965	0.0	671	654	0.554	0.555	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
2	Q5VYH9	0.0	734	565	0.550	0.637	Q5VYH9_HUMAN Lymphocyte antigen 9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
3	Q9HBG7	0.0	1353	655	1.000	1.000	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
4	Q18PI6	3.45e-39	149	329	0.139	0.277	SLAF5_MOUSE SLAM family member 5 OS=Mus musculus OX=10090 GN=Cd84 PE=1 SV=1
5	Q9UIB8	6.17e-35	137	345	0.140	0.267	SLAF5_HUMAN SLAM family member 5 OS=Homo sapiens OX=9606 GN=CD84 PE=1 SV=1
6	Q9D780	6.37e-34	133	285	0.122	0.281	SLAF9_MOUSE SLAM family member 9 OS=Mus musculus OX=10090 GN=Slamf9 PE=2 SV=2
7	Q96A28	9.12e-32	127	289	0.115	0.260	SLAF9_HUMAN SLAM family member 9 OS=Homo sapiens OX=9606 GN=SLAMF9 PE=2 SV=2
8	Q9NQ25	3.47e-26	112	335	0.099	0.194	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
9	Q8BHK6	4.02e-25	108	333	0.104	0.204	SLAF7_MOUSE SLAM family member 7 OS=Mus musculus OX=10090 GN=Slamf7 PE=1 SV=2
10	Q96DU3	1.07e-23	104	332	0.124	0.244	SLAF6_HUMAN SLAM family member 6 OS=Homo sapiens OX=9606 GN=SLAMF6 PE=1 SV=3
11	Q9ET39	2.13e-16	83.6	351	0.118	0.219	SLAF6_MOUSE SLAM family member 6 OS=Mus musculus OX=10090 GN=Slamf6 PE=1 SV=1
12	B4DW98	4.23e-13	71.6	241	0.064	0.174	B4DW98_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
13	P13688	1.98e-09	62.8	526	0.142	0.177	CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CEACAM1 PE=1 SV=2
14	Q9BZW8	2.61e-08	58.9	370	0.070	0.124	CD244_HUMAN Natural killer cell receptor 2B4 OS=Homo sapiens OX=9606 GN=CD244 PE=1 SV=2
15	P10252	7.15e-08	56.2	240	0.067	0.183	CD48_RAT CD48 antigen OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1
16	P18181	1.35e-07	55.5	240	0.067	0.183	CD48_MOUSE CD48 antigen OS=Mus musculus OX=10090 GN=Cd48 PE=1 SV=1
17	Q640R3	1.63e-07	56.6	418	0.066	0.103	HECAM_MOUSE Hepatic and glial cell adhesion molecule OS=Mus musculus OX=10090 GN=Hepacam PE=1 SV=2
18	Q14CZ8	1.64e-07	56.6	416	0.066	0.103	HECAM_HUMAN Hepatic and glial cell adhesion molecule OS=Homo sapiens OX=9606 GN=HEPACAM PE=1 SV=1
19	A8MVW5	1.21e-06	53.9	462	0.093	0.132	HECA2_HUMAN HEPACAM family member 2 OS=Homo sapiens OX=9606 GN=HEPACAM2 PE=1 SV=1
20	Q13291	1.20e-05	50.1	335	0.092	0.179	SLAF1_HUMAN Signaling lymphocytic activation molecule OS=Homo sapiens OX=9606 GN=SLAMF1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	4.2e-06	38.1	Immunoglobulin I-set domain
2	PF00047 ig	0.0019	29.7	Immunoglobulin domain
3	PF13895 Ig_2	3.1e-05	35.5	Immunoglobulin domain
4	PF13927 Ig_3	6.5e-07	41.1	Immunoglobulin domain
5	PF16706 Izumo-Ig	3.3e+02	12.6	Izumo-like Immunoglobulin domain
6	PF11465 Receptor_2B4	84	14.8	Natural killer cell receptor 2B4
7	PF07686 V-set	3.5e-08	45.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263285

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360181	0.947	SH2 domain-containing protein 1A
2	9606.ENSP00000411355	0.804	Receptor-type tyrosine-protein phosphatase C
3	9606.ENSP00000356906	0.793	SH2 domain-containing protein 1B
4	9606.ENSP00000484431	0.777	CD48 antigen
5	9606.ENSP00000046794	0.686	Lymphocyte cytosolic protein 2
6	9606.ENSP00000405338	0.677	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
7	9606.ENSP00000313967	0.676	Complement C1q subcomponent subunit B
8	9606.ENSP00000264972	0.672	Tyrosine-protein kinase ZAP-70
9	9606.ENSP00000289707	0.669	SLAM family member 8
10	9606.ENSP00000357981	0.667	Cathepsin S
11	9606.ENSP00000358490	0.647	T-cell surface antigen CD2
12	9606.ENSP00000363318	0.637	Cytokine receptor common subunit gamma
13	9606.ENSP00000358501	0.628	Lymphocyte function-associated antigen 3
14	9606.ENSP00000320563	0.627	WD repeat- and FYVE domain-containing protein 4
15	9606.ENSP00000248901	0.624	Cytohesin-4
16	9606.ENSP00000259089	0.624	Tyrosine-protein kinase Blk
17	9606.ENSP00000340944	0.623	Tyrosine-protein phosphatase non-receptor type 11
18	9606.ENSP00000331614	0.622	DNA-binding protein Ikaros
19	9606.ENSP00000306157	0.620	Interleukin-7 receptor subunit alpha
20	9606.ENSP00000333919	0.620	B- and T-lymphocyte attenuator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050896	0.988	response to stimulus
GO:0010628	0.988	positive regulation of gene expression
GO:0051240	0.970	positive regulation of multicellular organismal process
GO:0002376	0.965	immune system process
GO:0032501	0.963	multicellular organismal process
GO:1903131	0.962	mononuclear cell differentiation
GO:0042110	0.953	T cell activation
GO:0006955	0.951	immune response
GO:0001817	0.944	regulation of cytokine production
GO:0002252	0.943	immune effector process
GO:0030098	0.931	lymphocyte differentiation
GO:0030217	0.864	T cell differentiation
GO:0002250	0.836	adaptive immune response
GO:0002366	0.830	leukocyte activation involved in immune response
GO:0050794	0.822	regulation of cellular process
GO:0002285	0.793	lymphocyte activation involved in immune response
GO:0046631	0.767	alpha-beta T cell activation
GO:0046632	0.739	alpha-beta T cell differentiation
GO:0002286	0.727	T cell activation involved in immune response
GO:0035710	0.722	CD4-positive, alpha-beta T cell activation
GO:0002460	0.706	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0001819	0.641	positive regulation of cytokine production
GO:0002287	0.632	alpha-beta T cell activation involved in immune response
GO:0002292	0.632	T cell differentiation involved in immune response
GO:0045058	0.585	T cell selection
GO:0043367	0.527	CD4-positive, alpha-beta T cell differentiation
GO:0048583	0.378	regulation of response to stimulus
GO:0002682	0.353	regulation of immune system process
GO:0051716	0.326	cellular response to stimulus
GO:0045165	0.325	cell fate commitment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.694	intracellular anatomical structure
GO:0043226	0.663	organelle
GO:0043229	0.643	intracellular organelle
GO:0043227	0.517	membrane-bounded organelle
GO:0043231	0.396	intracellular membrane-bounded organelle
GO:0005737	0.319	cytoplasm
GO:0009986	0.313	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]