StarFunc result for job id Q9HBH0

User Input

>input (211 residues)
MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASV
TVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHF
CRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQGLSACEQIRAALYLECSAKFREN
VEDVFREAAKVALSALKKAQRQKKRRLCLLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBH0	1.000	1.000	8.688E-45	211	1.000	1.000	Q9HBH0.pdb.gz	RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens OX=9606 GN=RHOF PE=1 SV=1
2	AFDB:O00212	0.891	0.895	2.733E-31	210	0.493	0.495	O00212.pdb.gz	RHOD_HUMAN Rho-related GTP-binding protein RhoD OS=Homo sapiens OX=9606 GN=RHOD PE=1 SV=3
3	AFDB:P97348	0.934	0.938	3.101E-31	210	0.502	0.505	P97348.pdb.gz	RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus OX=10090 GN=Rhod PE=1 SV=1
4	AFDB:O42825	0.885	0.942	9.938E-30	198	0.469	0.500	O42825.pdb.gz	RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHO1 PE=3 SV=1
5	AFDB:A0A068C8U8	0.832	0.909	1.404E-28	193	0.445	0.487	A0A068C8U8.pdb.gz	A0A068C8U8_ASPFU Rho GTPase Rho1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=rho1 PE=1 SV=1
6	AFDB:Q09914	0.834	0.871	3.848E-28	202	0.431	0.450	Q09914.pdb.gz	RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rho1 PE=1 SV=1
7	AFDB:Q9HE04	0.833	0.878	1.055E-27	200	0.441	0.465	Q9HE04.pdb.gz	RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rho5 PE=3 SV=1
8	AFDB:P48148	0.833	0.914	2.249E-27	192	0.436	0.479	P48148.pdb.gz	RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster OX=7227 GN=Rho1 PE=1 SV=1
9	AFDB:Q6FQ78	0.842	0.846	2.249E-27	210	0.445	0.448	Q6FQ78.pdb.gz	Q6FQ78_CANGA Candida glabrata strain CBS138 chromosome I complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=RHO1 PE=4 SV=1
10	AFDB:P62745	0.836	0.900	2.717E-27	196	0.412	0.444	P62745.pdb.gz	RHOB_HUMAN Rho-related GTP-binding protein RhoB OS=Homo sapiens OX=9606 GN=RHOB PE=1 SV=1
11	PDB:6jikA	0.840	0.972	6.376E-27	182	0.445	0.516	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
12	PDB:5c2kA	0.841	0.466	8.454E-26	382	0.417	0.230	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
13	PDB:6hxuA	0.826	0.956	1.491E-25	182	0.408	0.473	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
14	PDB:4mitC	0.827	0.962	4.213E-24	181	0.384	0.448	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
15	PDB:6ukaA	0.814	0.967	6.550E-24	177	0.393	0.469	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
16	PDB:3a58F	0.824	0.958	6.976E-24	181	0.436	0.508	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
17	PDB:2wkpA	0.824	0.545	1.796E-23	320	0.412	0.272	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
18	PDB:1nf3A	0.816	0.886	1.118E-22	194	0.370	0.402	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
19	PDB:2atxA	0.819	0.926	4.764E-22	186	0.422	0.478	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
20	PDB:2j1lA	0.697	0.932	6.317E-21	157	0.384	0.516	2j1lA.pdb.gz	Crystal Structure of Human Rho-Related GTP-Binding Protein Rhod

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HBH0	7.60e-159	439	211	1.000	1.000	RHOF_HUMAN Rho-related GTP-binding protein RhoF OS=Homo sapiens OX=9606 GN=RHOF PE=1 SV=1
2	P97348	3.69e-79	237	210	0.498	0.500	RHOD_MOUSE Rho-related GTP-binding protein RhoD OS=Mus musculus OX=10090 GN=Rhod PE=1 SV=1
3	O00212	1.30e-77	233	210	0.469	0.471	RHOD_HUMAN Rho-related GTP-binding protein RhoD OS=Homo sapiens OX=9606 GN=RHOD PE=1 SV=3
4	Q9HE04	4.64e-70	214	200	0.474	0.500	RHO5_SCHPO GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rho5 PE=3 SV=1
5	O42825	4.17e-69	211	198	0.455	0.485	RHO1_CANAL GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RHO1 PE=3 SV=1
6	Q9C3Y4	1.05e-67	207	193	0.469	0.513	RHOA_EMENI GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhoA PE=3 SV=1
7	Q5DR84	3.91e-67	206	199	0.445	0.472	Q5DR84_ASPNG CorA-like Mg2+ transporter family protein OS=Aspergillus niger OX=5061 GN=AnigIFM60653_002925 PE=4 SV=1
8	P48148	6.48e-67	206	192	0.460	0.505	RHO1_DROME Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster OX=7227 GN=Rho1 PE=1 SV=1
9	A0A068C8U8	7.31e-67	205	193	0.469	0.513	A0A068C8U8_ASPFU Rho GTPase Rho1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=rho1 PE=1 SV=1
10	Q09914	1.23e-66	205	202	0.460	0.480	RHO1_SCHPO GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rho1 PE=1 SV=1
11	Q6FQ78	2.13e-66	205	210	0.474	0.476	Q6FQ78_CANGA Candida glabrata strain CBS138 chromosome I complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=RHO1 PE=4 SV=1
12	Q24814	3.67e-66	204	196	0.464	0.500	RACA_ENTH1 Rho-related protein racA OS=Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) OX=294381 GN=RACA PE=1 SV=1
13	A0JC80	4.13e-66	204	199	0.436	0.462	A0JC80_9HYPO RacA OS=Epichloe festucae OX=35717 GN=racA PE=2 SV=1
14	P48554	4.88e-66	203	192	0.460	0.505	RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster OX=7227 GN=Rac2 PE=1 SV=1
15	Q4WWL5	7.44e-66	203	199	0.441	0.467	Q4WWL5_ASPFU Rho GTPase Rac, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G06300 PE=4 SV=1
16	P15153	2.20e-65	202	192	0.460	0.505	RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens OX=9606 GN=RAC2 PE=1 SV=1
17	Q05144	5.33e-65	201	192	0.460	0.505	RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus OX=10090 GN=Rac2 PE=1 SV=1
18	Q5U1Y2	5.33e-65	201	192	0.460	0.505	Q5U1Y2_RAT Ras-related C3 botulinum toxin substrate 2 (Rho family, small GTP binding protein Rac2) OS=Rattus norvegicus OX=10116 GN=Rac2 PE=2 SV=1
19	J9VT08	5.80e-65	201	197	0.441	0.472	J9VT08_CRYNH GTP-binding protein rhoA OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_03315 PE=4 SV=1
20	P40792	8.24e-65	200	192	0.455	0.500	RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster OX=7227 GN=Rac1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.4e+02	14.2	AAA ATPase domain
2	PF13401 AAA_22	4.1e+02	12.6	AAA domain
3	PF00005 ABC_tran	1.4e+02	14.4	ABC transporter
4	PF00025 Arf	0.00032	31.7	ADP-ribosylation factor family
5	PF04670 Gtr1_RagA	4.3e+02	11.7	Gtr1/RagA G protein conserved region
6	PF01926 MMR_HSR1	1.2e+02	14.2	50S ribosome-binding GTPase
7	PF05729 NACHT	98	14.3	NACHT domain
8	PF00931 NB-ARC	1.6e+02	12.9	NB-ARC domain
9	PF00071 Ras	6.3e-46	167.4	Ras family
10	PF08477 Roc	1.4e-17	75.4	Ras of Complex, Roc, domain of DAPkinase
11	PF03193 RsgA_GTPase	2.7e+02	12.8	RsgA GTPase
12	PF09439 SRPRB	20	16.1	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267205

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269321	0.851	Rho GDP-dissociation inhibitor 1
2	9606.ENSP00000228945	0.789	Rho GDP-dissociation inhibitor 2
3	9606.ENSP00000365891	0.753	Wiskott-Aldrich syndrome protein
4	9606.ENSP00000404991	0.753	Transmembrane protein 120B
5	9606.ENSP00000219409	0.741	Rho GDP-dissociation inhibitor 3
6	9606.ENSP00000369318	0.708	Rho-related BTB domain-containing protein 3
7	9606.ENSP00000258390	0.705	Dedicator of cytokinesis protein 10
8	9606.ENSP00000365643	0.677	Dedicator of cytokinesis protein 9
9	9606.ENSP00000347486	0.657	MORN repeat containing 3
10	9606.ENSP00000430276	0.652	Proto-oncogene DBL
11	9606.ENSP00000451828	0.646	RAC-alpha serine/threonine-protein kinase
12	9606.ENSP00000479134	0.643	Formin-1
13	9606.ENSP00000472929	0.631	Proto-oncogene vav
14	9606.ENSP00000230449	0.624	Exocyst complex component 2
15	9606.ENSP00000437188	0.614	T-lymphoma invasion and metastasis-inducing protein 2
16	9606.ENSP00000276202	0.606	Dedicator of cytokinesis protein 11
17	9606.ENSP00000223023	0.590	Neural Wiskott-Aldrich syndrome protein
18	9606.ENSP00000449381	0.582	MAP kinase-activated protein kinase 5
19	9606.ENSP00000301037	0.568	Uncharacterized serine/threonine-protein kinase SgK494
20	9606.ENSP00000362680	0.566	Proto-oncogene tyrosine-protein kinase Src

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.997	molecular function regulator activity
GO:0003824	0.960	catalytic activity
GO:0003924	0.930	GTPase activity
GO:0030234	0.885	enzyme regulator activity
GO:1901363	0.879	heterocyclic compound binding
GO:0097159	0.879	organic cyclic compound binding
GO:0140677	0.876	molecular function activator activity
GO:0043168	0.856	anion binding
GO:0030695	0.851	GTPase regulator activity
GO:0140678	0.844	molecular function inhibitor activity
GO:0000166	0.806	nucleotide binding
GO:0032561	0.796	guanyl ribonucleotide binding
GO:0005085	0.718	guanyl-nucleotide exchange factor activity
GO:0035639	0.599	purine ribonucleoside triphosphate binding
GO:0005525	0.513	GTP binding
GO:0019899	0.376	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0071840	0.945	cellular component organization or biogenesis
GO:0051056	0.945	regulation of small GTPase mediated signal transduction
GO:0016043	0.933	cellular component organization
GO:0030029	0.871	actin filament-based process
GO:0030036	0.818	actin cytoskeleton organization
GO:0007015	0.770	actin filament organization
GO:0050896	0.760	response to stimulus
GO:0051716	0.618	cellular response to stimulus
GO:0023052	0.531	signaling
GO:0007154	0.531	cell communication
GO:0007165	0.467	signal transduction
GO:0048518	0.424	positive regulation of biological process
GO:0048522	0.388	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005886	0.998	plasma membrane
GO:0012505	0.987	endomembrane system
GO:0005576	0.975	extracellular region
GO:1903561	0.966	extracellular vesicle
GO:0005615	0.960	extracellular space
GO:0031090	0.947	organelle membrane
GO:0070062	0.916	extracellular exosome
GO:0031410	0.915	cytoplasmic vesicle
GO:0098588	0.899	bounding membrane of organelle
GO:0005829	0.883	cytosol
GO:0012506	0.505	vesicle membrane
GO:0030659	0.382	cytoplasmic vesicle membrane
GO:0099503	0.329	secretory vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.930	GTP + H2O = GDP + H(+) + phosphate

[back to server]