StarFunc result for job id Q9HBH7

User Input

>input (125 residues)
MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPIL
QYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDE
FCLMP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BXY8	0.597	0.584	1.693E-17	128	0.912	0.891	Q9BXY8.pdb.gz	BEX2_HUMAN Protein BEX2 OS=Homo sapiens OX=9606 GN=BEX2 PE=1 SV=1
2	AFDB:Q3MKQ1	0.461	0.449	1.281E-11	129	0.656	0.636	Q3MKQ1.pdb.gz	BEX2_RAT Protein BEX2 OS=Rattus norvegicus OX=10116 GN=Bex2 PE=1 SV=1
3	AFDB:Q9R224	0.484	0.474	8.956E-11	128	0.576	0.562	Q9R224.pdb.gz	BEX1_MOUSE Protein BEX1 OS=Mus musculus OX=10090 GN=Bex1 PE=1 SV=2
4	AFDB:Q00994	0.293	0.324	2.427E-3	111	0.312	0.351	Q00994.pdb.gz	BEX3_HUMAN Protein BEX3 OS=Homo sapiens OX=9606 GN=BEX3 PE=1 SV=1
5	AFDB:Q9CWT2	0.241	0.252	1.453E-2	118	0.256	0.271	Q9CWT2.pdb.gz	BEX4_MOUSE Protein BEX4 OS=Mus musculus OX=10090 GN=Bex4 PE=1 SV=1
6	AFDB:Q3MKP9	0.238	0.249	1.698E-2	118	0.272	0.288	Q3MKP9.pdb.gz	BEX4_RAT Protein BEX4 OS=Rattus norvegicus OX=10116 GN=Bex4 PE=3 SV=1
7	AFDB:Q9D2Q3	0.280	0.094	4.455E-1	444	0.216	0.061	Q9D2Q3.pdb.gz	PAAT_MOUSE ATPase PAAT OS=Mus musculus OX=10090 GN=Paat PE=2 SV=1
8	AFDB:Q3TZW7	0.190	0.204	4.815E-1	114	0.200	0.219	Q3TZW7.pdb.gz	BEX6_MOUSE Protein BEX6 OS=Mus musculus OX=10090 GN=Bex6 PE=3 SV=1
9	AFDB:Q8I1V4	0.385	0.164	4.815E-1	346	0.216	0.078	Q8I1V4.pdb.gz	Q8I1V4_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0413300 PE=4 SV=1
10	AFDB:Q8I4Q0	0.328	0.131	5.626E-1	375	0.200	0.067	Q8I4Q0.pdb.gz	Q8I4Q0_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1253700 PE=4 SV=1
11	PDB:5lj5O	0.195	0.100	6.133	283	0.160	0.071	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:7pubCI	0.157	0.048	9.782	427	0.072	0.021	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HBH7	1.14e-89	257	125	1.000	1.000	BEX1_HUMAN Protein BEX1 OS=Homo sapiens OX=9606 GN=BEX1 PE=1 SV=2
2	Q9BXY8	6.76e-71	209	128	0.912	0.891	BEX2_HUMAN Protein BEX2 OS=Homo sapiens OX=9606 GN=BEX2 PE=1 SV=1
3	Q3MKQ1	3.19e-52	162	129	0.776	0.752	BEX2_RAT Protein BEX2 OS=Rattus norvegicus OX=10116 GN=Bex2 PE=1 SV=1
4	Q9WTZ8	1.25e-51	161	129	0.752	0.729	BEX2_MOUSE Protein BEX2 OS=Mus musculus OX=10090 GN=Bex2 PE=1 SV=1
5	Q3MKQ2	9.20e-47	149	128	0.728	0.711	BEX1_RAT Protein BEX1 OS=Rattus norvegicus OX=10116 GN=Bex1 PE=1 SV=2
6	Q9R224	9.43e-45	144	128	0.712	0.695	BEX1_MOUSE Protein BEX1 OS=Mus musculus OX=10090 GN=Bex1 PE=1 SV=2
7	Q5H9J7	1.40e-16	71.6	111	0.392	0.441	BEX5_HUMAN Protein BEX5 OS=Homo sapiens OX=9606 GN=BEX5 PE=1 SV=1
8	Q00994	8.79e-15	67.0	111	0.392	0.441	BEX3_HUMAN Protein BEX3 OS=Homo sapiens OX=9606 GN=BEX3 PE=1 SV=1
9	Q9NWD9	1.41e-13	64.3	120	0.392	0.408	BEX4_HUMAN Protein BEX4 OS=Homo sapiens OX=9606 GN=BEX4 PE=1 SV=1
10	Q9WTZ9	5.47e-07	47.4	124	0.368	0.371	BEX3_MOUSE Protein BEX3 OS=Mus musculus OX=10090 GN=Bex3 PE=1 SV=1
11	Q6PDU5	6.61e-06	44.7	130	0.368	0.354	BEX3_RAT Protein BEX3 OS=Rattus norvegicus OX=10116 GN=Bex3 PE=2 SV=1
12	Q3MKP9	0.033	34.3	118	0.216	0.229	BEX4_RAT Protein BEX4 OS=Rattus norvegicus OX=10116 GN=Bex4 PE=3 SV=1
13	Q9CWT2	0.63	30.8	118	0.216	0.229	BEX4_MOUSE Protein BEX4 OS=Mus musculus OX=10090 GN=Bex4 PE=1 SV=1
14	Q5RIV1	1.0	31.2	892	0.152	0.021	Q5RIV1_DANRE Circadian locomoter output cycles protein kaput OS=Danio rerio OX=7955 GN=clock PE=1 SV=1
15	Q57WW7	1.2	30.8	388	0.128	0.041	Q57WW7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.620 PE=4 SV=1
16	P97326	1.6	30.4	790	0.112	0.018	CADH6_MOUSE Cadherin-6 OS=Mus musculus OX=10090 GN=Cdh6 PE=1 SV=2
17	Q3KNZ1	1.6	30.4	790	0.112	0.018	Q3KNZ1_MOUSE Cdh6 protein OS=Mus musculus OX=10090 GN=Cdh6 PE=1 SV=1
18	Q9USP3	3.1	29.6	443	0.112	0.032	PPR6_SCHPO Pentatricopeptide repeat-containing protein 6, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppr6 PE=4 SV=1
19	A0A1D8PQH0	9.1	28.1	765	0.096	0.016	A0A1D8PQH0_CANAL ATP-dependent DNA helicase CHL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04538 BEX	6.7e-27	105.8	Brain expressed X-linked like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000172229	0.969	Tumor necrosis factor receptor superfamily member 16
2	9606.ENSP00000358525	0.935	Beta-nerve growth factor
3	9606.ENSP00000220751	0.905	Receptor-interacting serine/threonine-protein kinase 2
4	9606.ENSP00000433623	0.904	TNF receptor-associated factor 6
5	9606.ENSP00000358519	0.825	Helix-loop-helix protein 2
6	9606.ENSP00000306772	0.775	LIM domain-binding protein 2
7	9606.ENSP00000392466	0.739	LIM domain-binding protein 1
8	9606.ENSP00000445683	0.706	G-protein coupled receptor-associated sorting protein 1
9	9606.ENSP00000436376	0.688	Olfactory marker protein
10	9606.ENSP00000442521	0.675	Protein BEX2
11	9606.ENSP00000257818	0.648	Rhombotin-2
12	9606.ENSP00000361765	0.625	Transcription elongation factor A protein-like 5
13	9606.ENSP00000361860	0.542	Transcription elongation factor A like family
14	9606.ENSP00000361866	0.514	Transcription elongation factor A protein-like 2
15	9606.ENSP00000361711	0.508	Transcription elongation factor A protein-like 3
16	9606.ENSP00000477981	0.505	Brain mitochondrial carrier protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0048522	0.988	positive regulation of cellular process
GO:0019222	0.937	regulation of metabolic process
GO:0060255	0.920	regulation of macromolecule metabolic process
GO:0051171	0.906	regulation of nitrogen compound metabolic process
GO:0080090	0.883	regulation of primary metabolic process
GO:0009987	0.844	cellular process
GO:0031323	0.753	regulation of cellular metabolic process
GO:0010468	0.742	regulation of gene expression
GO:0065009	0.722	regulation of molecular function
GO:0009893	0.695	positive regulation of metabolic process
GO:0006355	0.683	regulation of DNA-templated transcription
GO:0010604	0.611	positive regulation of macromolecule metabolic process
GO:0051173	0.568	positive regulation of nitrogen compound metabolic process
GO:0031325	0.517	positive regulation of cellular metabolic process
GO:0044093	0.494	positive regulation of molecular function
GO:0051090	0.430	regulation of DNA-binding transcription factor activity
GO:0050896	0.407	response to stimulus
GO:0045935	0.395	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.372	negative regulation of biological process
GO:0051716	0.345	cellular response to stimulus
GO:0048523	0.311	negative regulation of cellular process
GO:0045893	0.310	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.996	protein-containing complex
GO:0005737	0.979	cytoplasm
GO:0043229	0.965	intracellular organelle
GO:0043231	0.964	intracellular membrane-bounded organelle
GO:0070013	0.958	intracellular organelle lumen
GO:0005634	0.915	nucleus
GO:0005667	0.899	transcription regulator complex
GO:0031981	0.365	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]