StarFunc result for job id Q9HBI6

User Input

>input (524 residues)
MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWF
WGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPK
DMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQR
LASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQIL
LHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFID
VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQE
LLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC
LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALTLLHFRILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBI6	1.000	1.000	2.575E-83	524	1.000	1.000	Q9HBI6.pdb.gz	CP4FB_HUMAN Cytochrome P450 4F11 OS=Homo sapiens OX=9606 GN=CYP4F11 PE=1 SV=3
2	AFDB:P78329	0.978	0.985	2.144E-72	520	0.863	0.869	P78329.pdb.gz	CP4F2_HUMAN Cytochrome P450 4F2 OS=Homo sapiens OX=9606 GN=CYP4F2 PE=1 SV=1
3	AFDB:P33274	0.975	0.975	5.024E-70	524	0.786	0.786	P33274.pdb.gz	CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus OX=10116 GN=Cyp4f1 PE=1 SV=1
4	AFDB:Q08477	0.971	0.979	5.502E-70	520	0.823	0.829	Q08477.pdb.gz	CP4F3_HUMAN Cytochrome P450 4F3 OS=Homo sapiens OX=9606 GN=CYP4F3 PE=1 SV=2
5	AFDB:Q9HCS2	0.955	0.955	7.565E-70	524	0.830	0.830	Q9HCS2.pdb.gz	CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens OX=9606 GN=CYP4F12 PE=1 SV=3
6	AFDB:P98187	0.969	0.976	4.961E-68	520	0.786	0.792	P98187.pdb.gz	CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens OX=9606 GN=CYP4F8 PE=1 SV=1
7	AFDB:P51869	0.959	0.962	4.205E-67	522	0.781	0.784	P51869.pdb.gz	CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus OX=10116 GN=Cyp4f4 PE=1 SV=1
8	AFDB:Q99N16	0.972	0.972	8.848E-66	524	0.744	0.744	Q99N16.pdb.gz	CP4F3_MOUSE Cytochrome P450 4F3 OS=Mus musculus OX=10090 GN=Cyp4f3 PE=1 SV=2
9	AFDB:P51871	0.944	0.922	1.624E-64	537	0.735	0.717	P51871.pdb.gz	CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus OX=10116 GN=Cyp4f6 PE=2 SV=1
10	AFDB:P51870	0.933	0.930	3.266E-63	526	0.714	0.711	P51870.pdb.gz	CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus OX=10116 GN=Cyp4f5 PE=2 SV=1
11	PDB:5veuC	0.750	0.832	1.999E-24	469	0.225	0.252	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
12	PDB:5te8B	0.716	0.789	1.413E-23	471	0.225	0.251	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
13	PDB:5veuL	0.719	0.832	4.822E-23	448	0.214	0.250	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
14	PDB:7mk8B	0.710	0.793	4.822E-23	465	0.225	0.254	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
15	PDB:2j0dB	0.690	0.803	2.368E-22	445	0.223	0.263	2j0dB.pdb.gz	Structural Basis for Ligand Promiscuity in Cytochrome P450 3A4
16	PDB:3k9vA	0.713	0.797	1.163E-21	464	0.218	0.246	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
17	PDB:7kvjA	0.666	0.829	7.503E-21	415	0.221	0.280	7kvjA.pdb.gz	Rational Design of CYP3A4 Inhibitors: A One-Atom Linker Elongation in Ritonavir-Like Compounds Leads to a Marked Improvement in the Binding Strength.
18	PDB:5jlcA	0.713	0.736	1.295E-20	506	0.197	0.204	5jlcA.pdb.gz	Crystal Structures of Full-Length Lanosterol 14 alpha-Demethylases of Prominent Fungal Pathogens Candida albicans and Candida glabrata Provide Tools for Antifungal Discovery.
19	PDB:3na1A	0.722	0.795	1.553E-20	472	0.198	0.220	3na1A.pdb.gz	Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
20	PDB:5eqbA	0.688	0.680	1.701E-20	531	0.193	0.190	5eqbA.pdb.gz	Architecture of a single membrane spanning cytochrome P450 suggests constraints that orient the catalytic domain relative to a bilayer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P33274	0.0	864	524	0.786	0.786	CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus OX=10116 GN=Cyp4f1 PE=1 SV=1
2	P51869	0.0	839	522	0.781	0.784	CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus OX=10116 GN=Cyp4f4 PE=1 SV=1
3	P51870	0.0	782	526	0.716	0.713	CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus OX=10116 GN=Cyp4f5 PE=2 SV=1
4	P51871	0.0	814	537	0.735	0.717	CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus OX=10116 GN=Cyp4f6 PE=2 SV=1
5	P78329	0.0	946	520	0.863	0.869	CP4F2_HUMAN Cytochrome P450 4F2 OS=Homo sapiens OX=9606 GN=CYP4F2 PE=1 SV=1
6	P98187	0.0	848	520	0.769	0.775	CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens OX=9606 GN=CYP4F8 PE=1 SV=1
7	Q08477	0.0	894	520	0.823	0.829	CP4F3_HUMAN Cytochrome P450 4F3 OS=Homo sapiens OX=9606 GN=CYP4F3 PE=1 SV=2
8	Q6NT55	0.0	686	531	0.609	0.601	CP4FN_HUMAN Ultra-long-chain fatty acid omega-hydroxylase OS=Homo sapiens OX=9606 GN=CYP4F22 PE=1 SV=1
9	Q99N16	0.0	813	524	0.744	0.744	CP4F3_MOUSE Cytochrome P450 4F3 OS=Mus musculus OX=10090 GN=Cyp4f3 PE=1 SV=2
10	Q9HBI6	0.0	1083	524	1.000	1.000	CP4FB_HUMAN Cytochrome P450 4F11 OS=Homo sapiens OX=9606 GN=CYP4F11 PE=1 SV=3
11	Q9HCS2	0.0	913	524	0.830	0.830	CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens OX=9606 GN=CYP4F12 PE=1 SV=3
12	P08516	3.60e-144	426	509	0.427	0.440	CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus OX=10116 GN=Cyp4a10 PE=1 SV=2
13	P24464	4.72e-141	418	508	0.414	0.427	CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus OX=10116 GN=Cyp4a12 PE=1 SV=2
14	P20817	2.62e-140	416	507	0.422	0.436	CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus OX=10116 GN=Cyp4a14 PE=1 SV=2
15	O88833	4.81e-140	416	509	0.408	0.420	CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus OX=10090 GN=Cyp4a10 PE=1 SV=2
16	P13584	1.14e-138	412	511	0.410	0.421	CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens OX=9606 GN=CYP4B1 PE=1 SV=2
17	Q8N118	4.41e-138	410	509	0.387	0.399	CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens OX=9606 GN=CYP4X1 PE=1 SV=1
18	P20816	1.54e-137	409	504	0.416	0.433	CP4A2_RAT Cytochrome P450 4A2 OS=Rattus norvegicus OX=10116 GN=Cyp4a2 PE=1 SV=2
19	Q02928	1.76e-137	409	519	0.427	0.432	CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens OX=9606 GN=CYP4A11 PE=1 SV=1
20	P15129	9.06e-137	407	511	0.399	0.409	CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus OX=10116 GN=Cyp4b1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	1.6e-129	444.3	Cytochrome P450
2	PF08447 PAS_3	4.5e+02	12.6	PAS fold

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419970	0.702	NADPH--cytochrome P450 reductase
2	9606.ENSP00000333212	0.535	Cytochrome P450 2U1
3	9606.ENSP00000360247	0.530	Cytochrome P450 2J2
4	9606.ENSP00000260970	0.522	Peptidyl-prolyl cis-trans isomerase G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016705	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	1.000	monooxygenase activity
GO:0005488	0.996	binding
GO:0016709	0.784	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0005515	0.739	protein binding
GO:1901363	0.573	heterocyclic compound binding
GO:0097159	0.559	organic cyclic compound binding
GO:0043167	0.490	ion binding
GO:0036094	0.462	small molecule binding
GO:0020037	0.446	heme binding
GO:0016713	0.344	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.997	lipid metabolic process
GO:0032787	0.997	monocarboxylic acid metabolic process
GO:0006690	0.986	icosanoid metabolic process
GO:0006631	0.980	fatty acid metabolic process
GO:0033559	0.862	unsaturated fatty acid metabolic process
GO:0120254	0.855	olefinic compound metabolic process
GO:0001676	0.849	long-chain fatty acid metabolic process
GO:0019369	0.807	arachidonic acid metabolic process
GO:0050896	0.564	response to stimulus
GO:0065007	0.494	biological regulation
GO:1901615	0.430	organic hydroxy compound metabolic process
GO:1901360	0.386	organic cyclic compound metabolic process
GO:0008202	0.360	steroid metabolic process
GO:0065008	0.333	regulation of biological quality
GO:0042221	0.300	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	1.000	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.13.-	0.784	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.
EC:1.14.15.-	0.344	With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen.

[back to server]