StarFunc result for job id Q9HBL0

User Input

>input (1735 residues)
MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNL
SERRPDITKLHAKVLEFGWPDLHTPALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRI
GVVIAAYMHYSNISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMN
NKPLFLHHVIMHGIPNFESKGGCRPFLRIYQAMQPVYTSGIYNIPGDSQTSVCITIEPGL
LLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFPEYGKV
EFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHRDDGMEEVVGHTQGP
LDGSLYAKVKKKDSLHGSTGAVNATRPTLSATPNHVEHTLSVSSDSGNSTASTKTDKTDE
PVPGASSATAALSPQEKRELDRLLSGFGLEREKQGAMYHTQHLRSRPAGGSAVPSSGRHV
VPAQVHVNGGALASERETDILDDELPNQDGHSAGSMGTLSSLDGVTNTSEGGYPEALSPL
TNGLDKSYPMEPMVNGGGYPYESASRAGPAHAGHTAPMRPSYSAQEGLAGYQREGPHPAW
PQPVTTSHYAHDPSGMFRSQSFSEAEPQLPPAPVRGGSSREAVQRGLNSWQQQQQQQQQP
RPPPRQQERAHLESLVASRPSPQPLAETPIPSLPEFPRAASQQEIEQSIETLNMLMLDLE
PASAAAPLHKSQSVPGAWPGASPLSSQPLSGSSRQSHPLTQSRSGYIPSGHSLGTPEPAP
RASLESVPPGRSYSPYDYQPCLAGPNQDFHSKSPASSSLPAFLPTTHSPPGPQQPPASLP
GLTAQPLLSPKEATSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQPAEPPAPLRRRAASD
GQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAFEEMEGTS
PSSPPPSGVRSPPGLAKTPLSALGLKPHNPADILLHPTGVTRRRIQPEEDEGKVVVRLSE
EPRSYVESVARTAVAGPRAQDSEPKSFSAPATQAYGHEIPLRNGTLGGSFVSPSPLSTSS
PILSADSTSVGSFPSGESSDQGPRTPTQPLLESGFRSGSLGQPSPSAQRNYQSSSPLPTV
GSSYSSPDYSLQHFSSSPESQARAQFSVAGVHTVPGSPQARHRTVGTNTPPSPGFGWRAI
NPSMAAPSSPSLSHHQMMGPPGTGFHGSTVSSPQSSAATTPGSPSLCRHPAGVYQVSGLH
NKVATTPGSPSLGRHPGAHQGNLASGLHSNAIASPGSPSLGRHLGGSGSVVPGSPCLDRH
VAYGGYSTPEDRRPTLSRQSSASGYQAPSTPSFPVSPAYYPGLSSPATSPSPDSAAFRQG
SPTPALPEKRRMSVGDRAGSLPNYATINGKVSSPVASGMSSPSGGSTVSFSHTLPDFSKY
SMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRGAYGLA
MKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVYQHSII
PLALPCKLVIPNRDPTDESKDSSGPANSTADLLKQGAACNVLFVNSVDMESLTGPQAISK
ATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLDPQERKWMK
TEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q0S6	0.215	0.199	0.000	1888	0.889	0.817	E9Q0S6.pdb.gz	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1
2	AFDB:Q04205	0.223	0.222	0.000	1744	0.674	0.670	Q04205.pdb.gz	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
3	AFDB:Q5SSZ5	0.206	0.247	0.000	1440	0.402	0.484	Q5SSZ5.pdb.gz	TENS3_MOUSE Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1
4	AFDB:Q68CZ2	0.201	0.239	0.000	1445	0.407	0.489	Q68CZ2.pdb.gz	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
5	AFDB:Q9HBL0	1.000	1.000	0.000	1735	1.000	1.000	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
6	AFDB:Q63HR2	0.204	0.248	1.166E-91	1409	0.340	0.419	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
7	PDB:7jvxA	0.153	0.767	1.712E-21	314	0.056	0.312	7jvxA.pdb.gz
8	AFDB:Q9W2S5	0.067	0.055	1.548E-7	2139	0.134	0.109	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
9	AFDB:Q9VID5	0.052	0.079	2.106E-5	1039	0.077	0.129	Q9VID5.pdb.gz	Q9VID5_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8671 PE=3 SV=2
10	PDB:3qwyA	0.051	0.443	2.759E-5	170	0.022	0.224	3qwyA.pdb.gz
11	AFDB:Q6WKZ4	0.049	0.063	1.382E-4	1283	0.118	0.159	Q6WKZ4.pdb.gz	RFIP1_HUMAN Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3
12	PDB:4k2rA	0.064	0.179	1.719E-4	551	0.022	0.071	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
13	PDB:1fq1A	0.078	0.596	2.119E-4	183	0.020	0.186	1fq1A.pdb.gz	Phosphoprotein-protein interactions revealed by the crystal structure of kinase-associated phosphatase in complex with phosphoCDK2.
14	PDB:1griA	0.054	0.372	2.352E-4	211	0.020	0.166	1griA.pdb.gz
15	PDB:1k9aB	0.053	0.194	2.478E-4	441	0.021	0.082	1k9aB.pdb.gz
16	PDB:5bx1A	0.073	0.633	2.611E-4	153	0.013	0.150	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
17	PDB:5xzrA	0.064	0.174	3.391E-4	519	0.024	0.081	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
18	AFDB:Q8N3D4	0.064	0.071	3.542E-4	1523	0.118	0.135	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
19	PDB:2h8hA	0.052	0.188	3.765E-4	445	0.021	0.083	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
20	PDB:3s4oA	0.072	0.564	4.180E-4	163	0.018	0.190	3s4oA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y4T1	0.0	3473	1860	0.988	0.922	A0A2R8Y4T1_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
2	A0A494C067	0.0	3510	1827	0.995	0.945	A0A494C067_HUMAN Tensin 1 (Fragment) OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
3	E7ERH1	0.0	1376	780	0.378	0.840	E7ERH1_HUMAN Tensin 1 (Fragment) OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
4	E9PCX8	0.0	687	1249	0.223	0.310	E9PCX8_HUMAN Tensin 3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=9
5	E9PF55	0.0	3493	1721	0.992	1.000	E9PF55_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
6	E9PGF5	0.0	3481	1714	0.988	1.000	E9PGF5_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
7	E9Q0S6	0.0	3046	1888	0.886	0.815	TENS1_MOUSE Tensin-1 OS=Mus musculus OX=10090 GN=Tns1 PE=1 SV=1
8	H0Y4U1	0.0	1674	846	0.485	0.994	H0Y4U1_HUMAN Tensin 1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=1
9	Q04205	0.0	2040	1744	0.678	0.675	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
10	Q5SSZ5	0.0	676	1440	0.221	0.267	TENS3_MOUSE Tensin-3 OS=Mus musculus OX=10090 GN=Tns3 PE=1 SV=1
11	Q68CZ2	0.0	685	1445	0.222	0.266	TENS3_HUMAN Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3 PE=1 SV=2
12	Q9HBL0	0.0	3476	1839	0.988	0.932	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3
13	Q63HR2	5.71e-142	478	1409	0.137	0.169	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
14	Q8CGB6	2.65e-141	476	1400	0.136	0.169	TENS2_MOUSE Tensin-2 OS=Mus musculus OX=10090 GN=Tns2 PE=1 SV=1
15	F7FBH3	3.82e-138	468	1454	0.135	0.161	F7FBH3_RAT Tensin 2 OS=Rattus norvegicus OX=10116 GN=Tns2 PE=1 SV=1
16	Q8IZW8	1.51e-90	313	715	0.093	0.227	TENS4_HUMAN Tensin-4 OS=Homo sapiens OX=9606 GN=TNS4 PE=1 SV=3
17	H2L045	1.33e-88	320	1354	0.102	0.131	TENSH_CAEEL Tensin homolog OS=Caenorhabditis elegans OX=6239 GN=tns-1 PE=1 SV=2
18	Q9VHC3	1.80e-76	272	720	0.079	0.190	Q9VHC3_DROME Blistery, isoform A OS=Drosophila melanogaster OX=7227 GN=by PE=2 SV=1
19	Q99KY4	6.46e-38	158	1305	0.053	0.070	GAK_MOUSE Cyclin-G-associated kinase OS=Mus musculus OX=10090 GN=Gak PE=1 SV=2
20	O14976	9.13e-38	158	1311	0.054	0.071	GAK_HUMAN Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08416 PTB	5.5e-32	122.0	Phosphotyrosine-binding domain
2	PF10409 PTEN_C2	3e-28	109.7	C2 domain of PTEN tumour-suppressor protein
3	PF00017 SH2	1.9e-06	39.2	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000171887

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267257	0.993	Paxillin
2	9606.ENSP00000211998	0.983	Vinculin
3	9606.ENSP00000391669	0.981	Breast cancer anti-estrogen resistance protein 1
4	9606.ENSP00000276297	0.977	Rho GTPase-activating protein 7
5	9606.ENSP00000263967	0.969	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
6	9606.ENSP00000341189	0.967	Focal adhesion kinase 1
7	9606.ENSP00000362680	0.962	Proto-oncogene tyrosine-protein kinase Src
8	9606.ENSP00000379975	0.961	Integrin-linked protein kinase
9	9606.ENSP00000334008	0.958	Alpha-parvin
10	9606.ENSP00000379350	0.957	Integrin beta-1
11	9606.ENSP00000400175	0.952	Transforming protein RhoA
12	9606.ENSP00000324422	0.950	Zyxin
13	9606.ENSP00000346300	0.946	Crk-like protein
14	9606.ENSP00000316029	0.945	Talin-1
15	9606.ENSP00000428056	0.944	Phosphatidylinositol 3-kinase regulatory subunit alpha
16	9606.ENSP00000446121	0.942	LIM and senescent cell antigen-like-containing domain protein 1
17	9606.ENSP00000220003	0.940	Tyrosine-protein kinase CSK
18	9606.ENSP00000377941	0.924	Alpha-actinin-1
19	9606.ENSP00000252699	0.917	Alpha-actinin-4
20	9606.ENSP00000443495	0.915	Alpha-actinin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.951	heterocyclic compound binding
GO:0097159	0.951	organic cyclic compound binding
GO:0003676	0.882	nucleic acid binding
GO:0003723	0.844	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0048870	0.986	cell motility
GO:0022607	0.965	cellular component assembly
GO:0016477	0.941	cell migration
GO:0050789	0.866	regulation of biological process
GO:0050794	0.861	regulation of cellular process
GO:0032501	0.658	multicellular organismal process
GO:0048518	0.651	positive regulation of biological process
GO:0048583	0.644	regulation of response to stimulus
GO:0001667	0.634	ameboidal-type cell migration
GO:0048519	0.627	negative regulation of biological process
GO:0048522	0.627	positive regulation of cellular process
GO:0009966	0.562	regulation of signal transduction
GO:0048523	0.530	negative regulation of cellular process
GO:0034330	0.528	cell junction organization
GO:0032502	0.525	developmental process
GO:0048856	0.508	anatomical structure development
GO:0050896	0.411	response to stimulus
GO:0034329	0.391	cell junction assembly
GO:0008152	0.372	metabolic process
GO:1902531	0.365	regulation of intracellular signal transduction
GO:0051716	0.334	cellular response to stimulus
GO:0007154	0.308	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005925	0.998	focal adhesion
GO:0005829	0.927	cytosol
GO:0043226	0.809	organelle
GO:0043229	0.792	intracellular organelle
GO:0071944	0.509	cell periphery
GO:0005886	0.494	plasma membrane
GO:0043231	0.412	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]