StarFunc result for job id Q9HBM6

User Input

>input (251 residues)
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSH
AKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRY
CLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTS
QRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKR
KHEDDDDNDIM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q62880	0.824	0.803	9.706E-33	258	0.896	0.872	Q62880.pdb.gz	TAF9B_RAT Transcription initiation factor TFIID subunit 9B OS=Rattus norvegicus OX=10116 GN=Taf9b PE=2 SV=2
2	AFDB:Q16594	0.745	0.713	5.149E-29	264	0.821	0.780	Q16594.pdb.gz	TAF9_HUMAN Transcription initiation factor TFIID subunit 9 OS=Homo sapiens OX=9606 GN=TAF9 PE=1 SV=1
3	PDB:7ktrE	0.441	0.842	2.215E-17	124	0.494	1.000	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
4	AFDB:Q27272	0.485	0.438	4.327E-15	278	0.363	0.327	Q27272.pdb.gz	TAF9_DROME Transcription initiation factor TFIID subunit 9 OS=Drosophila melanogaster OX=7227 GN=e(y)1 PE=1 SV=1
5	AFDB:Q9SYH2	0.474	0.643	2.586E-13	183	0.275	0.377	Q9SYH2.pdb.gz	TAF9_ARATH Transcription initiation factor TFIID subunit 9 OS=Arabidopsis thaliana OX=3702 GN=TAF9 PE=1 SV=1
6	PDB:6mzcM	0.371	0.838	4.424E-12	104	0.367	0.885	6mzcM.pdb.gz
7	PDB:6t9iF	0.417	0.898	5.213E-7	111	0.163	0.369	6t9iF.pdb.gz
8	AFDB:Q9ZQH2	0.254	0.233	1.627E-3	275	0.139	0.127	Q9ZQH2.pdb.gz	DPB4_ARATH DNA polymerase II subunit B4 OS=Arabidopsis thaliana OX=3702 GN=NF-YB11 PE=1 SV=1
9	PDB:7egdF	0.254	0.161	6.103E-3	412	0.080	0.049	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
10	PDB:7pj1B	0.238	0.457	7.439E-3	122	0.052	0.107	7pj1B.pdb.gz
11	AFDB:Q8W0W9	0.237	0.202	1.177E-2	296	0.151	0.128	Q8W0W9.pdb.gz	Q8W0W9_ORYSA Repressor protein OS=Oryza sativa OX=4530 GN=Dr1 PE=1 SV=1
12	PDB:6t9iE	0.243	0.143	1.642E-2	433	0.108	0.062	6t9iE.pdb.gz
13	PDB:7edxc	0.245	0.467	1.873E-2	127	0.072	0.142	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
14	PDB:3v9rA	0.243	0.634	2.439E-2	88	0.068	0.193	3v9rA.pdb.gz
15	PDB:7r5sS	0.223	0.433	2.605E-2	120	0.056	0.117	7r5sS.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
16	PDB:1kx5B	0.245	0.569	2.783E-2	102	0.056	0.137	1kx5B.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
17	AFDB:Q8W0W7	0.230	0.224	4.123E-2	258	0.179	0.174	Q8W0W7.pdb.gz	Q8W0W7_ORYSA Repressor protein OS=Oryza sativa OX=4530 GN=DrAp1 PE=1 SV=1
18	AFDB:P79007	0.243	0.152	6.543E-2	415	0.131	0.080	P79007.pdb.gz	HAP5_SCHPO Transcriptional activator hap5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hap5 PE=2 SV=1
19	AFDB:P91156	0.109	0.060	6.543E-2	580	0.151	0.066	P91156.pdb.gz	P91156_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acin-1 PE=1 SV=2
20	AFDB:Q9GSP1	0.250	0.186	6.543E-2	341	0.155	0.114	Q9GSP1.pdb.gz	Q9GSP1_DROME LD24434p OS=Drosophila melanogaster OX=7227 GN=NC2alpha PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HBM6	0.0	507	251	1.000	1.000	TAF9B_HUMAN Transcription initiation factor TFIID subunit 9B OS=Homo sapiens OX=9606 GN=TAF9B PE=1 SV=1
2	Q62880	2.01e-160	446	258	0.876	0.853	TAF9B_RAT Transcription initiation factor TFIID subunit 9B OS=Rattus norvegicus OX=10116 GN=Taf9b PE=2 SV=2
3	Q5BKE0	2.22e-139	394	264	0.817	0.777	TAF9_RAT Transcription initiation factor TFIID subunit 9 OS=Rattus norvegicus OX=10116 GN=Taf9 PE=2 SV=1
4	Q16594	2.89e-139	393	264	0.801	0.761	TAF9_HUMAN Transcription initiation factor TFIID subunit 9 OS=Homo sapiens OX=9606 GN=TAF9 PE=1 SV=1
5	Q8VI33	1.02e-138	392	264	0.805	0.765	TAF9_MOUSE Transcription initiation factor TFIID subunit 9 OS=Mus musculus OX=10090 GN=Taf9 PE=1 SV=1
6	D6RIE8	2.25e-112	323	197	0.641	0.817	D6RIE8_HUMAN Transcription initiation factor TFIID subunit 9 (Fragment) OS=Homo sapiens OX=9606 GN=TAF9 PE=1 SV=9
7	Q27272	1.39e-48	163	278	0.343	0.309	TAF9_DROME Transcription initiation factor TFIID subunit 9 OS=Drosophila melanogaster OX=7227 GN=e(y)1 PE=1 SV=1
8	Q9SYH2	4.47e-39	135	183	0.251	0.344	TAF9_ARATH Transcription initiation factor TFIID subunit 9 OS=Arabidopsis thaliana OX=3702 GN=TAF9 PE=1 SV=1
9	Q09869	2.49e-31	115	163	0.195	0.301	TAF9_SCHPO Transcription initiation factor TFIID subunit 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf9 PE=1 SV=1
10	Q05027	2.26e-22	92.0	157	0.179	0.287	TAF9_YEAST Transcription initiation factor TFIID subunit 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF9 PE=1 SV=1
11	O45784	1.89e-16	77.0	183	0.155	0.213	TAF9_CAEEL Transcription initiation factor TFIID subunit 9 OS=Caenorhabditis elegans OX=6239 GN=taf-9 PE=1 SV=1
12	Q5BF86	9.88e-16	77.0	287	0.191	0.167	Q5BF86_EMENI Transcription initiation factor TFIID, 31kD subunit, putative (AFU_orthologue AFUA_1G14600) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00794 PE=3 SV=1
13	Q01705	0.017	38.9	2531	0.116	0.011	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
14	Q07008	0.077	36.6	2531	0.112	0.011	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
15	Q3E835	0.44	32.0	90	0.056	0.156	CENPS_YEAST Inner kinetochore subunit MHF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MHF1 PE=1 SV=1
16	P61830	0.88	32.0	136	0.048	0.088	H3_YEAST Histone H3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HHT1 PE=1 SV=2
17	P61833	0.88	32.0	136	0.048	0.088	H3_CANGA Histone H3 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=HHT1 PE=3 SV=2
18	E1BSW7	1.8	31.2	139	0.048	0.086	CENPS_CHICK Centromere protein S OS=Gallus gallus OX=9031 GN=CENPS PE=1 SV=2
19	Q8N2Z9	1.9	31.2	138	0.044	0.080	CENPS_HUMAN Centromere protein S OS=Homo sapiens OX=9606 GN=CENPS PE=1 SV=1
20	O00308	2.7	32.0	870	0.080	0.023	WWP2_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07524 Bromo_TP	0.63	21.4	Bromodomain associated
2	PF15630 CENP-S	0.083	24.6	CENP-S protein
3	PF15511 CENP-T_C	2.1e+02	13.4	Centromere kinetochore component CENP-T histone fold
4	PF00125 Histone	52	15.6	Core histone H2A/H2B/H3/H4
5	PF02291 TFIID-31kDa	2.8e-46	168.0	Transcription initiation factor IID, 31kD subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000022945

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000017766	0.994	Transcription initiation factor TFIID subunit 7
2	9601.ENSPPYP00000001889	0.991	TAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 20kDa
3	9601.ENSPPYP00000019499	0.991	TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa
4	9601.ENSPPYP00000018575	0.990	TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
5	9601.ENSPPYP00000022899	0.990	TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa
6	9601.ENSPPYP00000003048	0.989	TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
7	9601.ENSPPYP00000001258	0.988	Transcription initiation factor TFIID subunit 13
8	9601.ENSPPYP00000015293	0.988	Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex. Also known as a coactivator for p53/TP53- dependent transcriptional activation (By similarity). Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4 (By similarity)
9	9601.ENSPPYP00000018476	0.988	Transcription initiation factor TFIID subunit 11
10	9601.ENSPPYP00000023973	0.988	TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa
11	9601.ENSPPYP00000004055	0.986	Transcription initiation factor TFIID subunit 10
12	9601.ENSPPYP00000019457	0.986	Transformation/transcription domain-associated protein
13	9601.ENSPPYP00000024034	0.986	Uncharacterized protein
14	9601.ENSPPYP00000015742	0.983	K(lysine) acetyltransferase 2B
15	9601.ENSPPYP00000018640	0.983	SPT3 homolog, SAGA and STAGA complex component
16	9601.ENSPPYP00000016284	0.973	Coactivates PAX5-dependent transcription together with either SMARCA4 or GCN5L2
17	9601.ENSPPYP00000019257	0.968	TATA box binding protein
18	9601.ENSPPYP00000002407	0.966	TAF3 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 140kDa
19	9601.ENSPPYP00000010191	0.956	TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
20	9601.ENSPPYP00000006636	0.941	TATA box binding protein like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	0.999	RNA polymerase II general transcription initiation factor activity
GO:0005515	0.999	protein binding
GO:0003712	0.999	transcription coregulator activity
GO:0016740	0.931	transferase activity
GO:1901363	0.913	heterocyclic compound binding
GO:0097159	0.911	organic cyclic compound binding
GO:0003677	0.895	DNA binding
GO:0008134	0.622	transcription factor binding
GO:0003714	0.603	transcription corepressor activity
GO:0003713	0.362	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0009889	0.984	regulation of biosynthetic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0010468	0.982	regulation of gene expression
GO:0048522	0.979	positive regulation of cellular process
GO:1903508	0.954	positive regulation of nucleic acid-templated transcription
GO:0006355	0.936	regulation of DNA-templated transcription
GO:0006357	0.928	regulation of transcription by RNA polymerase II
GO:0045893	0.897	positive regulation of DNA-templated transcription
GO:0009987	0.832	cellular process
GO:0050896	0.783	response to stimulus
GO:0071704	0.645	organic substance metabolic process
GO:0044238	0.644	primary metabolic process
GO:0006807	0.617	nitrogen compound metabolic process
GO:0044237	0.617	cellular metabolic process
GO:0048583	0.584	regulation of response to stimulus
GO:0043170	0.570	macromolecule metabolic process
GO:0048519	0.566	negative regulation of biological process
GO:0090304	0.542	nucleic acid metabolic process
GO:0045944	0.537	positive regulation of transcription by RNA polymerase II
GO:0010467	0.535	gene expression
GO:0009059	0.535	macromolecule biosynthetic process
GO:0034654	0.526	nucleobase-containing compound biosynthetic process
GO:0006351	0.520	DNA-templated transcription
GO:0045927	0.507	positive regulation of growth
GO:0023051	0.486	regulation of signaling
GO:0010646	0.485	regulation of cell communication
GO:0071840	0.377	cellular component organization or biogenesis
GO:0042221	0.346	response to chemical
GO:0016043	0.328	cellular component organization
GO:0006366	0.307	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:1990234	0.995	transferase complex
GO:0000123	0.993	histone acetyltransferase complex
GO:0005669	0.993	transcription factor TFIID complex
GO:0070461	0.967	SAGA-type complex
GO:0033276	0.446	transcription factor TFTC complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.931	Transferases.

[back to server]