StarFunc result for job id Q9HBR0

User Input

>input (1119 residues)
MTAAAASNWGLITNIVNSIVGVSVLTMPFCFKQCGIVLGALLLVFCSWMTHQSCMFLVKS
ASLSKRRTYAGLAFHAYGKAGKMLVETSMIGLMLGTCIAFYVVIGDLGSNFFARLFGFQV
GGTFRMFLLFAVSLCIVLPLSLQRNMMASIQSFSAMALLFYTVFMFVIVLSSLKHGLFSG
QWLRRVSYVRWEGVFRCIPIFGMSFACQSQVLPTYDSLDEPSVKTMSSIFASSLNVVTTF
YVMVGFFGYVSFTEATAGNVLMHFPSNLVTEMLRVGFMMSVAVGFPMMILPCRQALSTLL
CEQQQKDGTFAAGGYMPPLRFKALTLSVVFGTMVGGILIPNVETILGLTGATMGSLICFI
CPALIYKKIHKNALSSQVVLWVGLGVLVVSTVTTLSVSEEVPEDLAEEAPGGRLGEAEGL
MKVEAARLSAQDPVVAVAEDGREKPKLPKEREELEQAQIKGPVDVPGREDGKEAPEEAQL
DRPGQGIAVPVGEAHRHEPPVPHDKVVVDEGQDREVPEENKPPSRHAGGKAPGVQGQMAP
PLPDSEREKQEPEQGEVGKRPGQAQALEEAGDLPEDPQKVPEADGQPAVQPAKEDLGPGD
RGLHPRPQAVLSEQQNGLAVGGGEKAKGGPPPGNAAGDTGQPAEDSDHGGKPPLPAEKPA
PGPGLPPEPREQRDVERAGGNQAASQLEEAGRAEMLDHAVLLQVIKEQQVQQKRLLDQQE
KLLAVIEEQHKEIHQQRQEDEEDKPRQVEVHQEPGAAVPRGQEAPEGKARETVENLPPLP
LDPVLRAPGGRPAPSQDLNQRSLEHSEGPVGRDPAGPPDGGPDTEPRAAQAKLRDGQKDA
APRAAGTVKELPKGPEQVPVPDPAREAGGPEERLAEEFPGQSQDVTGGSQDRKKPGKEVA
ATGTSILKEANWLVAGPGAETGDPRMKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPE
LRVISDGEQGGQQGHRLDHGGHLEMRKARGGDHVPVSHEQPRGGEDAAVQEPRQRPEPEL
GLKRAVPGGQRPDNAKPNRDLKLQAGSDLRRRRRDLGPHAEGQLAPRDGVIIGLNPLPDV
QVNDLRGALDAQLRQAAGGALQVVHSRQLRQAPGPPEES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBR0	0.999	0.999	0.000	1119	1.000	1.000	Q9HBR0.pdb.gz	S38AA_HUMAN Solute carrier family 38 member 10 OS=Homo sapiens OX=9606 GN=SLC38A10 PE=1 SV=2
2	AFDB:Q5I012	0.539	0.552	6.018E-78	1090	0.683	0.701	Q5I012.pdb.gz	S38AA_MOUSE Solute carrier family 38 member 10 OS=Mus musculus OX=10090 GN=Slc38a10 PE=1 SV=2
3	PDB:7kgvB	0.286	0.752	3.076E-10	404	0.060	0.166	7kgvB.pdb.gz
4	PDB:7kgvA	0.267	0.785	7.110E-9	361	0.056	0.175	7kgvA.pdb.gz
5	PDB:7cmhB	0.282	0.634	1.206E-7	458	0.051	0.124	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
6	PDB:6jmqA	0.260	0.643	2.341E-7	403	0.060	0.166	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
7	PDB:7p9uB	0.232	0.503	2.558E-7	455	0.044	0.108	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
8	PDB:7s1xB	0.236	0.293	9.642E-7	871	0.064	0.083	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
9	PDB:7dskB	0.255	0.541	1.639E-6	464	0.054	0.129	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
10	PDB:6li9B	0.275	0.599	5.657E-6	458	0.050	0.122	6li9B.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
11	AFDB:Q9W1J0	0.222	0.211	1.021E-5	1188	0.153	0.144	Q9W1J0.pdb.gz	Q9W1J0_DROME Transporter OS=Drosophila melanogaster OX=7227 GN=GlyT PE=3 SV=2
12	PDB:7d10A	0.265	0.582	3.038E-5	446	0.061	0.152	7d10A.pdb.gz
13	PDB:5j4nA	0.248	0.542	5.399E-5	437	0.055	0.140	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
14	AFDB:A0A0B4K822	0.069	0.068	1.011E-1	1136	0.114	0.113	A0A0B4K822.pdb.gz	A0A0B4K822_DROME Missing-in-metastasis, isoform H OS=Drosophila melanogaster OX=7227 GN=mim PE=4 SV=1
15	AFDB:Q9VUH6	0.044	0.033	2.051E-1	1833	0.141	0.086	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
16	AFDB:Q8IMA8	0.042	0.041	2.674E-1	1192	0.089	0.084	Q8IMA8.pdb.gz	PANG2_DROME Protein pangolin, isoform J OS=Drosophila melanogaster OX=7227 GN=pan PE=1 SV=2
17	AFDB:F4HZK4	0.064	0.048	3.054E-1	1608	0.103	0.072	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
18	AFDB:A0A509AIR7	0.047	0.050	3.982E-1	1031	0.080	0.087	A0A509AIR7.pdb.gz	OMG1_PLABA Ookinete maturation protein 1 OS=Plasmodium berghei (strain Anka) OX=5823 GN=OMG1 PE=2 SV=1
19	AFDB:Q9XZ21	0.035	0.032	5.192E-1	1231	0.101	0.092	Q9XZ21.pdb.gz	Q9XZ21_DROME Something that sticks like glue, isoform A OS=Drosophila melanogaster OX=7227 GN=snama PE=1 SV=1
20	AFDB:Q9VW47	0.051	0.032	5.427E-1	2531	0.124	0.055	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5I012	0.0	1343	1090	0.685	0.704	S38AA_MOUSE Solute carrier family 38 member 10 OS=Mus musculus OX=10090 GN=Slc38a10 PE=1 SV=2
2	Q9HBR0	0.0	2247	1119	1.000	1.000	S38AA_HUMAN Solute carrier family 38 member 10 OS=Homo sapiens OX=9606 GN=SLC38A10 PE=1 SV=2
3	Q9LI61	4.29e-21	100	460	0.088	0.215	AVT6A_ARATH Amino acid transporter AVT6A OS=Arabidopsis thaliana OX=3702 GN=AVT6A PE=2 SV=1
4	P39981	5.82e-21	100	480	0.096	0.223	AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT2 PE=2 SV=1
5	F8VQW8	4.99e-20	95.1	344	0.058	0.189	F8VQW8_HUMAN Solute carrier family 38 member 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=1
6	Q9JHZ9	1.50e-19	95.9	504	0.088	0.194	S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc38a3 PE=1 SV=1
7	Q9DCP2	1.97e-19	95.5	505	0.088	0.194	S38A3_MOUSE Sodium-coupled neutral amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc38a3 PE=1 SV=1
8	Q99624	1.02e-17	90.1	504	0.089	0.198	S38A3_HUMAN Sodium-coupled neutral amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC38A3 PE=1 SV=1
9	Q57Y06	3.25e-17	88.2	471	0.087	0.206	Q57Y06_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.560 PE=4 SV=1
10	Q381K0	6.89e-17	87.4	462	0.092	0.223	Q381K0_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7520 PE=4 SV=1
11	Q57WK1	1.11e-16	86.7	471	0.085	0.202	Q57WK1_TRYB2 Amino acid transporter AATP5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28A12.310 PE=4 SV=1
12	Q9JHE5	1.90e-16	86.3	504	0.084	0.187	S38A2_RAT Sodium-coupled neutral amino acid symporter 2 OS=Rattus norvegicus OX=10116 GN=Slc38a2 PE=1 SV=1
13	Q96QD8	1.07e-15	84.0	506	0.058	0.128	S38A2_HUMAN Sodium-coupled neutral amino acid symporter 2 OS=Homo sapiens OX=9606 GN=SLC38A2 PE=1 SV=2
14	Q9NVC3	1.01e-14	80.5	462	0.067	0.162	S38A7_HUMAN Sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens OX=9606 GN=SLC38A7 PE=1 SV=1
15	Q57V86	1.41e-14	80.1	466	0.088	0.210	Q57V86_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.170 PE=4 SV=1
16	Q8BWH0	1.99e-13	76.3	463	0.065	0.158	S38A7_MOUSE Sodium-coupled neutral amino acid transporter 7 OS=Mus musculus OX=10090 GN=Slc38a7 PE=1 SV=1
17	Q584L8	3.25e-13	75.5	451	0.088	0.220	Q584L8_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.60 PE=4 SV=1
18	Q8R1S9	3.30e-12	72.8	547	0.044	0.090	S38A4_MOUSE Sodium-coupled neutral amino acid transporter 4 OS=Mus musculus OX=10090 GN=Slc38a4 PE=1 SV=1
19	Q584M0	4.40e-12	72.0	450	0.087	0.216	Q584M0_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.40 PE=4 SV=1
20	Q969I6	9.57e-12	71.2	547	0.045	0.091	S38A4_HUMAN Sodium-coupled neutral amino acid transporter 4 OS=Homo sapiens OX=9606 GN=SLC38A4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01490 Aa_trans	3e-49	179.5	Transmembrane amino acid transporter protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363891

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000329795	0.619	Transmembrane protein 105
2	9606.ENSP00000380074	0.600	Sodium-coupled neutral amino acid transporter 9
3	9606.ENSP00000359292	0.599	SMC5-SMC6 complex localization factor protein 2
4	9606.ENSP00000336724	0.586	TBC1 domain family member 22A
5	9606.ENSP00000394757	0.572	Zinc finger protein 516
6	9606.ENSP00000385545	0.569	Kinesin-like protein KIF26B
7	9606.ENSP00000339626	0.549	Solute carrier family 35 member E4
8	9606.ENSP00000300714	0.546	AP-4 complex accessory subunit Tepsin
9	9606.ENSP00000411355	0.546	Receptor-type tyrosine-protein phosphatase C
10	9606.ENSP00000453129	0.546	N-acetylgalactosamine kinase
11	9606.ENSP00000351138	0.539	Mitoguardin 2
12	9606.ENSP00000337804	0.518	Sperm-associated antigen 17
13	9606.ENSP00000363929	0.508	Nuclear receptor coactivator 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015179	1.000	L-amino acid transmembrane transporter activity
GO:0015175	1.000	neutral L-amino acid transmembrane transporter activity
GO:0005515	0.996	protein binding
GO:0015291	0.905	secondary active transmembrane transporter activity
GO:1901702	0.534	salt transmembrane transporter activity
GO:0015075	0.490	monoatomic ion transmembrane transporter activity
GO:0015318	0.480	inorganic molecular entity transmembrane transporter activity
GO:0008324	0.480	monoatomic cation transmembrane transporter activity
GO:0022890	0.325	inorganic cation transmembrane transporter activity
GO:0022853	0.321	active monoatomic ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0001501	0.953	skeletal system development
GO:0060348	0.891	bone development
GO:0009987	0.650	cellular process
GO:0065007	0.429	biological regulation
GO:0051179	0.313	localization
GO:0050789	0.305	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005794	0.994	Golgi apparatus
GO:0016020	0.932	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]